Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR520 IGR524 IGR526 IGR521 IGR522 IGR523 IGR527 IGR525 flbD, - TP0726 flgD, - TP0728 deoD, - TP0734 motA, - TP0725 folD, - TP0732 flgE, - TP0727 glt, - TP0735 tap1, - TP0729 TP0733 TP0731 pss,pgsA, - TP0730 flbD, - TP0726 flgD, - TP0728 deoD, - TP0734 motA, - TP0725 folD, - TP0732 flgE, - TP0727 glt, - TP0735 tap1, - TP0729 TP0733 TP0731 pss,pgsA, - TP0730 Type: tandem, Name:  - 168 flbD, - TP0726 flgD, - TP0728 deoD, - TP0734 motA, - TP0725 folD, - TP0732 flgE, - TP0727 glt, - TP0735 tap1, - TP0729 TP0733 TP0731 pss,pgsA, - TP0730
* Calculated from Protein Sequence

Gene ID: TP0730

DNA Molecule Name:
1  

Genbank ID:
3323035

Gene Name:
pss  pgsA  

Definition:
phosphatidyltransferase

Gene Start:
795557

Gene Stop:
796651

Gene Length:
1095

Molecular Weight*:
39786

pI*:
10.42

Net Charge*:
17.30

EC:
2.7.8.-  

Functional Class:
Fatty acid and phospholipid metabolism  

Pathway: pathway table
Miscellaneous Enzymes

Comment:
At this time we are unable to make a call for this gene as it has
hits to both pgsA and pss genes

This protein may have an extra N-terminal region.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed the middle portion of the protein significantly
hit the N-terminal region of two pgsA genes. For example residues
174-279 are 33% similar to PGSA_MYCTU putative, pgp synthase of
Mycobacterium tuberculosis,(Z78020).

COGS Summary:  COGS Search
BeTs to 14 clades of COG0558
COG name: Phosphatidylglycerophosphate synthase
Functional Class:  I
The phylogenetic pattern of COG0558 is A-tKYQvcEbRhujgpOLINx
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
Significant (99%) hits to blocks (BL00379) CDP-alcohol phosphatidyltransferases
proteins with residues 223- 248 matching well with PSS_YEAST. Residues
98-117 represent a significant (98%) hit to blocks (PR00140B),
PYRROLIDONE CARBOXYL PEPTIDASE SIGNATURE.

ProDom Summary:  Protein Domain Search
Residues 203-257 are 30% similar to phosphatidylserine synthase of
PSS_YEAST, however the E value for this hit is weak.

Paralogs:  Local Blast Search
This protein is weakly homologous to TP0671, sn-1,2-diacylglycerol
cholinephosphotransferase. Residues 182-259 are 31% similar to TP0671.

Pfam Summary:  Pfam Search
Residues 214 to 357 (E-value = 2.3e-22) place TP0730 in the CDP-OH_P_transf family which is described as CDP-alcohol phosphatidyltransferase (PF01066)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
119  
140
transmembrane  
184  
202
transmembrane  
206  
223
transmembrane  
251  
268
transmembrane  
272  
289
transmembrane  
334  
351

PDB Hit:
none

Gene Protein Sequence:
MARASSPLSSMHSPHSLPFSAHCAARLRKKTCQSGSDASFQYKAHEKFST
LPKAPARRFFPVQYFPVSPDKRWILGYFSPPSMEKETAGILCSYTLFHSA
LVLALSLAHGRTQVPPSSTLSFLTVIVLWHCLLFFFLVAYSREPADTTVP
FKPLPEQTAPICAAASSDCKENRTALKTLNTATHITLIRASAIPIVGFLL
KFHALAGLSYFLVAGLSVLFLTDFIDGKIARARRETSRVGETLDAASDYA
LIGLISALYYQSGVVPLWFFVLIITRLSLQTVIACVYALFGHPMTGSTAG
GKATVAVTMLLYTLELARLLLPNLARSNSGARFFTGAEILAGFVIFTGIV
EKLYLGVQHRPGRSP

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCCCGTGCCAGCAGTCCTCTCAGTTCCATGCACTCCCCCCACTCCCT
GCCATTCTCGGCGCACTGCGCAGCACGTCTTAGAAAAAAGACCTGCCAGT
CCGGTTCGGACGCATCTTTTCAATACAAAGCGCACGAGAAATTCAGCACC
CTCCCAAAGGCTCCAGCACGCCGCTTCTTTCCCGTTCAGTATTTCCCCGT
TTCCCCTGACAAAAGATGGATTCTCGGATACTTTTCCCCTCCGTCTATGG
AAAAGGAAACAGCTGGCATTCTCTGCTCCTATACGCTTTTTCACAGTGCG
CTCGTGCTGGCGCTGTCCCTCGCGCACGGGCGTACCCAGGTGCCCCCCAG
CTCCACGCTCAGCTTTTTAACGGTCATTGTACTCTGGCACTGTCTGCTCT
TCTTTTTTCTTGTCGCGTATAGCAGAGAACCTGCAGATACCACCGTGCCG
TTTAAACCGCTGCCTGAACAGACAGCGCCTATTTGTGCCGCCGCATCTTC
TGACTGTAAGGAGAACCGCACCGCGCTGAAAACGCTGAACACTGCAACGC
ACATCACGCTTATCCGTGCCAGTGCTATTCCTATCGTTGGCTTTCTGCTT
AAATTCCACGCACTGGCGGGGCTTTCTTACTTCCTCGTTGCAGGACTGAG
CGTTTTGTTCCTCACCGATTTTATCGATGGCAAAATTGCCCGCGCAAGAC
GAGAAACGTCCCGCGTGGGAGAAACGCTCGACGCAGCAAGCGACTACGCG
CTTATCGGGCTCATCTCAGCGCTTTACTACCAAAGCGGTGTGGTGCCCCT
GTGGTTCTTTGTGCTTATCATCACCCGGCTTTCGTTACAAACGGTTATTG
CCTGTGTGTACGCGCTTTTTGGCCACCCGATGACCGGTTCCACCGCGGGG
GGCAAAGCGACGGTGGCCGTGACTATGCTCCTGTACACGCTCGAACTTGC
CCGTCTCCTGCTGCCGAACCTTGCGCGATCAAACAGCGGCGCGCGCTTTT
TTACCGGGGCAGAAATCCTTGCAGGATTCGTCATTTTCACCGGGATAGTG
GAAAAACTGTATCTTGGCGTTCAGCATCGCCCAGGACGCTCCCCG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy