Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap tRNA-Pro-3 IGR505 IGR501 IGR504 IGR500 IGR499 IGR502 IGR506 IGR503 IGR507 TP0699 TP0701 TP0700 TP0702 TP0698 TP0697 TP0703 TP0696 TP0706 recJ, - TP0704 pbp, - TP0705 TP0699 TP0701 TP0700 TP0702 TP0698 TP0697 TP0703 TP0696 TP0706 recJ, - TP0704 pbp, - TP0705 Type: tandem, Name:  - 163 Type: tandem, Name:  - 164 TP0702 TP0698 TP0703 TP0696 TP0706 recJ, - TP0704 pbp, - TP0705 TP0700 TP0697 TP0699 TP0701
* Calculated from Protein Sequence

Gene ID: TP0704

DNA Molecule Name:
1  

Genbank ID:
3323008

Gene Name:
recJ  

Definition:
single-stranded-DNA-specific exonuclease

Gene Start:
770690

Gene Stop:
768573

Gene Length:
2118

Molecular Weight*:
78755

pI*:
7.89

Net Charge*:
7.64

EC:
3.1.-.-  

Functional Class:
Replication; Degradation of DNA  

Pathway: pathway table
Miscellaneous Enzymes

Comment:
RecJ is required for many types of recombinational events, although
the stringency of the requirement for RecJ appears to vary with the
type of recombinational event monitored and the recombination gene
products which are available.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significnat hits to single-stranded-DNA-
specific exonuclease. For example residues 1-689 are 24% similar to
single-stranded-DNA-specific exonuclease of Borrelia burgdorferi,
(AE001136).

COGS Summary:  COGS Search
BeTs to 12 clades of COG0608
COG name: Single-stranded DNA-specific exonuclease
Functional Class:  L
The phylogenetic pattern of COG0608 is AMTk-qvceB-hUJ--olinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 354-703 are 29% similar to single-stranded-DNA-specific
exonuclease of RECJ_ECOLI. Residues 47-205 also support this match.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 72 to 228 (E-value = 2.2e-22) place TP0704 in the DHH family which is described as DHH family (PF01368)
Residues 511 to 575 (E-value = 5.1e-10) place TP0704 in the DHHA1 family which is described as DHHA1 domain (PF02272)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
431  
493

PDB Hit:
none

Gene Protein Sequence:
MKRWRAKALDEGRVRELTARYSCSALEAAILVRRKVVDADALLFHFERDL
RYLPGPFRFHAMSAAVDRLRLAHERKEKVLIFGDRDADGISATTLLFEAL
CAFGLTVCWRVPVADEPYGLSCNAVDEHAAAGGTLIVTVDCGISNRAEIA
YARHRGIDVLVIDHHAAPETLPDAIIINAKVPGAGYPHEFLSGCATAWKV
VTALRFSTSGWYQRPVVLLHVRPVTGAYTIEAVKMCNMEVVDRLSETVVP
RMLLPSHTRLGAFLEGQEVFVWDEQVVRTQLAKVFGGEFPWRFTDVRPRM
AAFFPQCERASLLRMKDFSRIGRARSKPMEEIESFINLFITFVQKDTQLY
RGAADELQLVAISTLSDLMVLAGENRIMVRYGLQAMNEAPRVGLRELFAI
QRLMGKKLGTVEVGWSIVPLINATGRLGCPHRAVELFLMREASQRALQAR
KMVQLNEQRKKLGRSARALVEPLARASLETYSNRLAVVCSDKIHRGVTGI
LANCLSEALRVPCVIICIMADGHAVGSLRSARGYHLFSLLDPLADLFSDY
GGHAFAAGFSIPSERIPQLLHRMELYAATIEFADESAQECGEFDAELDAT
QMTRGLLTLVDRFEPYGEGNPPLCFLAKRLKIFSASLFGRTERVHVKLTL
DAQVHKWPAIYWGAGEKLAQEFAVGDVVDAVFQVTRNTFQGTCTPQLVIQ
DLWRSE

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAACGGTGGCGTGCAAAGGCACTTGACGAAGGGCGTGTCCGCGAGCT
TACCGCGCGGTATAGCTGCTCGGCGCTTGAGGCGGCCATCCTTGTGCGTC
GCAAGGTAGTGGATGCTGACGCACTCCTTTTTCATTTTGAGCGTGATCTA
CGCTATCTGCCAGGACCGTTCCGTTTCCATGCGATGAGCGCTGCAGTTGA
CCGTTTGCGTCTTGCGCATGAGCGGAAAGAAAAGGTGCTCATCTTTGGTG
ATCGTGATGCAGACGGTATTAGCGCCACCACCCTTCTTTTTGAGGCTCTC
TGTGCATTTGGCTTGACGGTGTGCTGGCGCGTGCCGGTTGCCGATGAGCC
CTATGGGCTCTCGTGCAATGCAGTAGATGAGCATGCGGCCGCAGGGGGTA
CTCTCATTGTGACCGTTGACTGCGGTATTTCTAATCGCGCAGAAATTGCG
TATGCGCGTCACAGAGGTATTGACGTACTGGTTATTGATCACCATGCGGC
CCCTGAGACACTCCCTGATGCAATTATCATTAATGCAAAAGTGCCAGGTG
CAGGGTATCCGCACGAGTTTCTCTCAGGCTGTGCAACTGCGTGGAAGGTG
GTAACGGCGCTCCGTTTCAGTACCAGCGGCTGGTATCAGCGGCCTGTGGT
GCTTCTACACGTTCGTCCGGTGACTGGGGCGTATACGATTGAGGCTGTAA
AAATGTGTAATATGGAGGTGGTGGACCGTCTTTCGGAAACGGTGGTCCCA
CGTATGCTCCTGCCATCTCATACGCGTCTTGGTGCCTTCCTGGAGGGTCA
GGAAGTTTTCGTATGGGATGAGCAGGTGGTGCGCACGCAGTTGGCCAAAG
TGTTTGGTGGAGAGTTTCCCTGGCGTTTTACCGATGTGCGGCCGCGTATG
GCCGCGTTTTTTCCCCAATGTGAACGCGCAAGCCTTTTAAGGATGAAGGA
CTTTTCTCGCATTGGGCGTGCGCGCTCAAAACCGATGGAGGAAATCGAAA
GCTTTATCAATCTTTTTATAACTTTTGTGCAGAAAGATACCCAGCTCTAC
CGGGGCGCGGCGGATGAATTGCAGCTTGTGGCAATTTCTACGCTTTCTGA
TCTTATGGTGTTGGCGGGGGAGAACCGTATTATGGTCCGCTACGGTCTGC
AGGCGATGAATGAGGCGCCACGTGTGGGTTTGCGTGAGTTGTTTGCGATA
CAGCGTCTCATGGGGAAGAAGTTAGGAACCGTAGAGGTAGGGTGGAGTAT
TGTGCCGCTTATCAATGCAACGGGGCGGTTAGGGTGTCCGCACCGTGCAG
TGGAACTGTTTTTAATGCGCGAAGCTTCGCAGCGCGCGCTGCAGGCACGA
AAAATGGTGCAATTGAACGAACAGCGAAAAAAGTTAGGAAGGAGTGCTCG
TGCACTTGTTGAGCCTCTTGCGCGTGCAAGTCTTGAGACGTACAGCAACC
GCCTGGCAGTGGTTTGTAGCGATAAGATTCATCGGGGCGTTACGGGGATT
CTTGCAAACTGTTTGAGCGAGGCGCTGCGCGTGCCTTGTGTGATCATTTG
TATAATGGCAGACGGGCACGCGGTAGGATCGTTGCGTTCGGCGCGGGGAT
ATCACCTATTTTCGCTCTTAGATCCCCTTGCAGACTTGTTCTCTGACTAT
GGGGGGCATGCATTTGCGGCGGGTTTTTCAATTCCCTCTGAGCGAATTCC
CCAGCTATTGCACCGTATGGAACTGTATGCGGCAACCATTGAGTTTGCTG
ATGAAAGCGCGCAAGAGTGTGGAGAATTTGATGCAGAACTGGATGCTACG
CAGATGACGCGGGGGCTTTTGACCCTTGTCGATCGCTTTGAGCCGTACGG
AGAAGGCAATCCCCCGTTGTGCTTTTTGGCGAAGAGATTGAAAATTTTTT
CTGCATCGCTTTTTGGGCGTACAGAACGTGTGCACGTAAAATTGACCTTG
GATGCACAGGTGCATAAATGGCCCGCAATTTACTGGGGAGCAGGGGAAAA
GTTGGCACAGGAGTTTGCAGTGGGGGATGTAGTTGACGCGGTTTTTCAAG
TGACGCGTAACACGTTTCAGGGAACGTGCACACCGCAGCTGGTCATTCAA
GATTTGTGGAGGAGTGAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy