Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap tRNA-Met-3 IGR501 IGR495 IGR500 IGR494 IGR499 IGR498 IGR502 IGR497 IGR496 TP0699 TP0701 TP0700 TP0698 TP0697 TP0691 TP0696 recA, - TP0692 TP0693 TP0689 TP0694 TP0695 TP0699 TP0701 TP0700 TP0698 TP0697 TP0691 TP0696 recA, - TP0692 TP0693 TP0689 TP0694 TP0695 Type: tandem, Name:  - 163 Type: tandem, Name:  - 162 Type: tandem, Name:  - 264 Type: tandem, Name:  - 160 Type: tandem, Name:  - 265 Type: tandem, Name:  - 263 Type: tandem, Name:  - 161 Type: tandem, Name:  - 164 TP0701 TP0698 TP0697 TP0691 TP0696 recA, - TP0692 TP0693 TP0690 TP0689 TP0700 TP0690 TP0699 TP0694 TP0695
* Calculated from Protein Sequence

Gene ID: TP0694

DNA Molecule Name:
1  

Genbank ID:
3322996

Gene Name:


Definition:
possible 5,10-methenyltetrahydrofolate synthetase (5-formyltetrahydrofolate cyclo-ligase)

Gene Start:
761695

Gene Stop:
762369

Gene Length:
675

Molecular Weight*:
24393

pI*:
10.59

Net Charge*:
12.86

EC:
6.3.3.2  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Folic acid  

Pathway: pathway table
Metabolism of cofactors, vitamins, and other substances; One carbon pool by folate

Comment:
Reaction:
ATP + 5-FORMYLTETRAHYDROFOLATE =
ADP + ORTHOPHOSPHATE + 5,10-METHENYLTETRAHYDROFOLATE.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed only one significant hit across the entire protein.
Residues 3-205 are 26% similar to FTHC_RABIT, 5,10-methenyltetrahydrofolate
synthetase of rabbit.

COGS Summary:  COGS Search
BeTs to 10 clades of COG0212
COG name: 5-formyltetrahydrofolate cyclo-ligase
Functional Class:  H
The phylogenetic pattern of COG0212 is --t-yq-cebrhujgp-linx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 179-213 are 45% similar to YQGN_BACSU, a hypothetical protein,
with similarity to mammalian 5,10-methenyltetrahydrofolate synthetase.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 4 to 207 (E-value = 2.2e-77) place TP0694 in the 5-FTHF_cyc-lig family which is described as 5-formyltetrahydrofolate cyclo-ligase family (PF01812)

Structural Feature(s):
Feature Type  Start  Stop
gram positive/gram negative signal  
1  
26

PDB Hit:
none

Gene Protein Sequence:
MNAKQNARRIASARLRAFRASPTAPAYPAHSLFTAQTAYQRARTVFFYAP
LPLEIDPYALAYTAENAGKHVALPRVSGNDLHFHAVTYACTTRPSVSCFT
TLCPRTRGIREPDAHSPRLYPPHPSPNTPAQRTLALPLLIVVPALAFSTN
GARLGRGGGHYDRFLARIAATIPAGSYYTLGLCFDCQIMAVIPQEAHDQS
VHAVLTETRLISCATARAPAPPFSL

Gene Nucleotide Sequence:  Sequence Viewer
ATGAACGCAAAGCAAAATGCCCGTCGCATCGCTTCCGCACGGCTGCGCGC
CTTCCGCGCCTCCCCTACCGCTCCTGCCTATCCAGCACACTCCCTTTTCA
CTGCACAGACAGCGTACCAGCGTGCACGCACTGTGTTCTTCTATGCGCCC
CTGCCCCTAGAAATAGACCCCTACGCCCTTGCATACACTGCAGAAAACGC
AGGAAAGCACGTAGCTCTTCCTCGCGTATCGGGAAACGACTTGCACTTTC
ACGCAGTCACGTACGCGTGCACTACCCGCCCCTCTGTTTCCTGCTTCACC
ACCTTGTGCCCTAGGACCAGGGGAATTAGAGAACCCGATGCACACAGTCC
ACGCCTCTACCCCCCGCACCCTTCGCCCAATACTCCTGCACAAAGAACAC
TTGCCCTACCGCTTTTGATCGTAGTTCCCGCACTGGCATTCAGCACAAAT
GGCGCACGCCTCGGCCGCGGCGGAGGACACTACGATCGCTTCCTCGCCCG
GATCGCCGCTACCATACCAGCAGGGAGCTACTACACGCTCGGCCTCTGCT
TTGATTGCCAAATCATGGCTGTCATTCCTCAAGAAGCACACGACCAATCC
GTACACGCGGTGCTCACCGAAACTCGTCTCATTTCCTGTGCCACGGCGCG
TGCACCAGCGCCACCGTTCTCTTTA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy