Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap tRNA-Val-2 IGR490 IGR484 IGR485 IGR486 IGR487 IGR489 IGR483 IGR488 ftsJ, - TP0682 gcp, - TP0680 alr, - TP0681 TP0679 TP0678 ispB, - TP0683 mglB, - TP0684 mglA, - TP0685 mglC, - TP0686 ftsJ, - TP0682 gcp, - TP0680 alr, - TP0681 TP0679 TP0678 ispB, - TP0683 mglB, - TP0684 mglA, - TP0685 mglC, - TP0686 Type: tandem, Name:  - 158 Type: tandem, Name:  - 262 Type: tandem, Name:  - 297 ftsJ, - TP0682 gcp, - TP0680 alr, - TP0681 TP0679 TP0678 ispB, - TP0683 mglB, - TP0684 mglA, - TP0685 mglC, - TP0686
* Calculated from Protein Sequence

Gene ID: TP0683

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ispB  

Definition:
octaprenyl-diphosphate synthase/ farnesyltranstransferase

Gene Start:
746875

Gene Stop:
747966

Gene Length:
1092

Molecular Weight*:
40158

pI*:
10.07

Net Charge*:
19.53

EC:
2.5.1.-  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Menaquinone and ubiquinone  

Pathway: pathway table
Metabolism of cofactors, vitamins, and other substances; Ubiquinone biosynthesis

Secondary Evidence:
Kainou T, Okada K, Suzuki K, Nakagawa T, Matsuda H, Kawamukai M.
Dimer formation of octaprenyl-diphosphate synthase (IspB) is essential for chain length determination of ubiquinone.
J Biol Chem. 2001 Mar;276(11):7876-83.
PMID: 11108713

Okada K, Minehira M, Zhu X, Suzuki K, Nakagawa T, Matsuda H, Kawamukai M.
The ispB gene encoding octaprenyl diphosphate synthase is essential for growth of Escherichia coli.
J Bacteriol. 1997 May;179(9):3058-60.
PMID: 9139929

Asai K, Fujisaki S, Nishimura Y, Nishino T, Okada K, Nakagawa T, Kawamukai M, Matsuda H.
The identification of Escherichia coli ispB (cel) gene encoding the octaprenyl diphosphate synthase.
Biochem Biophys Res Commun. 1994 Jul;202(1):340-5.
PMID: 8037730

Comment:
Octaprenyl-diphosphate synthase supplies octaprenyl diphosphate, the
precursor for the side chain of the isoprenoid quinones ubiquinone and
menaquinone.

Farnesyltranstransferase catalyzes the trans-addition of the three
molecules of IPP onto DMAPP to form geranylgeranyl pyrophosphate which
is a precursor of the ether-linked lipids.
Reactions:
DIMETHYLALLYL DIPHOSPHATE + ISOPENTENYL DIPHOSPHATE =
PYROPHOSPHATE + GERANYL DIPHOSPHATE.
GERANYL DIPHOSPHATE + ISOPENTENYL DIPHOSPHATE =
PYROPHOSPHATE + TRANS,TRANS-FARNESYL DIPHOSPHATE.
TRANS-TRANS-FARNESYL DIPHOSPHATE + ISOPENTENYL DIPHOSPHATE =
PYROPHOSPHATE + GERANYLGERANYL DIPHOSPHATE.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed this protein is identical to octaprenyl-diphosphate
synthase of Treponema pallidum,(U95214). In addition there were
several significant hits to both octaprenyl-diphosphate synthases and
farnesyltranstransferases.

COGS Summary:  COGS Search
BeTs to 16 clades of COG0142
COG name: Geranylgeranyl pyrophosphate synthase
Functional Class:? H
The phylogenetic pattern of COG0142 is AmtkYQVCEBRHUJ--olinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 55-65, 102-145, 168-211, 239-261, 261-272, and 132-143
represent (100%) hits to blocks BL00723A,B,D,E, Polyprenyl
synthetases proteins. Residues 248-267 represent a significant (98%)
but unlikely hit to block PR00757A, FLAVIN-CONTAINING AMINE OXIDASE
SIGNATURE.

ProDom Summary:  Protein Domain Search
Residues 101-180 are 37% similar to geranylgeranyl pyrophosphate
synthase of GGPP_NEUCR. Residues 88-144, 182-284, and 220-299 also
support a match to geranylgeranyl pyrophosphate synthases/
geranyltranstransferase/ farnesyltransferase proteins.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 43 to 320 (E-value = 2.1e-27) place TP0683 in the polyprenyl_synt family which is described as Polyprenyl synthetase (PF00348)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
140  
174

PDB Hit:
gi|1942050|pdb|1UBX| Structure Of Farnesyl Pyrophosphate Synthetase Transferase, Isoprene Biosynthesis, Cholesterol Biosynthesis Mol_id: 1; Molecule: Farnesyl Diphosphate Synthase; Chain: Null; Synonym: Fps; Ec: 2.5.1.1; Engineered: Yes; Mutation: F11...

Gene Protein Sequence:
MKRALAQRLRNIERALADALPAQPTRSWMGTRLRVLASEDTRVLRTVCNA
CVSCGGKRWRPLLLILSAELAHACVQCTHRKLQGHKRKKISEREWYTLSA
VVELIHTASLLHDDIEDHSSTRRGKPCAYLRYGTDCVLNAASWLYFHAHA
LIDTLSIEPALKAALFSATISATRALHMGQALDIAWHRSPELIPSRAQYL
RMVALKTGALIALSGELGFLCAGYSAREARSFGAQVMPIGIGFQILDDVQ
GIDGGVSGKAHADDIVEGKKSFPVILHVHTHPQDAPTFARLFAAARAEGL
HSPAVKQAQRILYSSEALTHARAYGLRMIERTLTRVHAHFPCNPACQLWC
TAVQYGVRAHLHAH

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAACGTGCACTTGCTCAACGACTCAGAAATATTGAACGAGCACTCGC
CGATGCACTTCCTGCGCAACCTACGCGCTCGTGGATGGGAACGCGGCTCC
GTGTCCTTGCGTCCGAAGATACGCGCGTCCTGCGCACCGTGTGCAACGCG
TGTGTCAGCTGCGGCGGAAAGCGCTGGAGACCGTTGTTACTGATACTTTC
TGCAGAACTTGCACACGCGTGTGTGCAGTGCACGCATCGGAAACTCCAAG
GACACAAGAGGAAGAAAATTTCCGAACGCGAATGGTACACACTGAGCGCG
GTAGTAGAGCTCATTCACACAGCCAGCCTTTTGCACGATGATATTGAGGA
CCATTCGTCTACGCGGCGTGGTAAGCCATGTGCGTATCTGCGCTACGGTA
CTGACTGCGTTCTTAATGCAGCAAGCTGGTTGTATTTTCATGCACACGCA
CTCATTGACACGCTCAGCATAGAACCTGCCCTTAAGGCGGCTCTTTTTTC
TGCCACGATAAGTGCAACGCGTGCTCTTCATATGGGTCAGGCGCTTGATA
TTGCATGGCATCGCAGCCCAGAACTTATTCCCTCGCGTGCGCAGTATCTG
CGTATGGTTGCACTGAAAACTGGCGCACTCATCGCTCTATCAGGCGAATT
GGGGTTTTTGTGTGCAGGTTATTCTGCGCGTGAGGCGCGCTCCTTTGGAG
CGCAAGTCATGCCTATTGGGATAGGATTTCAGATTCTCGATGATGTACAA
GGCATTGACGGAGGTGTTTCAGGCAAAGCGCACGCTGATGACATCGTCGA
AGGAAAGAAGAGCTTTCCTGTTATCCTTCACGTGCACACGCATCCTCAAG
ACGCACCTACATTTGCACGTCTTTTTGCTGCCGCACGCGCAGAAGGACTG
CACTCTCCTGCAGTCAAACAGGCACAACGGATACTGTATTCTTCAGAGGC
ACTTACTCACGCGCGCGCGTACGGCCTGCGCATGATAGAGCGCACACTCA
CACGGGTGCACGCACATTTTCCTTGCAATCCTGCATGCCAGCTGTGGTGT
ACTGCAGTGCAGTATGGGGTACGCGCGCACCTGCACGCGCAC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy