Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap tRNA-Val-2 IGR481 IGR482 IGR484 IGR485 IGR486 IGR487 IGR489 IGR483 IGR488 TP0676 ftsJ, - TP0682 TP0677 gcp, - TP0680 alr, - TP0681 TP0679 TP0678 TP0675 ispB, - TP0683 mglB, - TP0684 mglA, - TP0685 TP0676 ftsJ, - TP0682 TP0677 gcp, - TP0680 alr, - TP0681 TP0679 TP0678 TP0675 ispB, - TP0683 mglB, - TP0684 mglA, - TP0685 Type: tandem, Name:  - 315 Type: tandem, Name:  - 158 Type: tandem, Name:  - 262 Type: tandem, Name:  - 297 ftsJ, - TP0682 TP0677 gcp, - TP0680 alr, - TP0681 TP0676 TP0679 TP0678 TP0675 ispB, - TP0683 mglB, - TP0684 mglA, - TP0685
* Calculated from Protein Sequence

Gene ID: TP0681

DNA Molecule Name:
1  

Genbank ID:
3322978

Gene Name:
alr  

Definition:
alanine racemase

Gene Start:
746091

Gene Stop:
745021

Gene Length:
1071

Molecular Weight*:
38086

pI*:
7.89

Net Charge*:
7.33

EC:
5.1.1.1  

Functional Class:
Cell envelope; Murein sacculus and peptidoglycan  

Pathway: pathway table
Miscellaneous Enzymes

Secondary Evidence:
Kim MG, Strych U, Krause K, Benedik M, Kohn H.
N(2)-substituted D,L-cycloserine derivatives: synthesis and evaluation as alanine racemase inhibitors.
J Antibiot (Tokyo). 2003 Feb;56(2):160-8.
PMID: 12715876

Tauch A, Götker S, Pühler A, Kalinowski J, Thierbach G.
The alanine racemase gene alr is an alternative to antibiotic resistance genes in cloning systems for industrial Corynebacterium glutamicum strains.
J Biotechnol. 2002 Oct;99(1):79-91.
PMID: 12204559

Strych U, Penland RL, Jimenez M, Krause KL, Benedik MJ.
Characterization of the alanine racemases from two mycobacteria.
FEMS Microbiol Lett. 2001 Mar;196(2):93-8.
PMID: 11267762

Comment:
Reaction:
L-ALANINE = D-ALANINE.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to alanine racemase
proteins. For example residues 6-355 are 36% similar to ALR_MYCTU,
alanine racemase of Mycobacterium tuberculosis,(Z77165). In addition
the N-terminal portion of this protein has been previously identified
as alanine racemase of Treponema pallidum,(U57756).

COGS Summary:  COGS Search
BeTs to 9 clades of COG0787
COG name: Alanine racemase
Functional Class:? M
The phylogenetic pattern of COG0787 is -----q-cEBrhuj--ol--x
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 10-20, 33-61, 111-139, 104-116, 184-212, 236-284, and 323-351
represent significant (100%) hits to blocks BL00395A,B,C,D,E,F, Alanine
racemase pyridoxal-phosphate attachment site proteins.

ProDom Summary:  Protein Domain Search
Residues 6-351 are 36% similar to alanine racemase of ALR_MYCTU.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 3 to 213 (E-value = 5e-82) place TP0681 in the Ala_racemase_N family which is described as Alanine racemase, N-terminal domain (PF01168)
Residues 226 to 356 (E-value = 1.4e-66) place TP0681 in the Ala_racemase_C family which is described as Alanine racemase, C-terminal domain (PF00842)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
106

PDB Hit:
gi|1942328|pdb|1SFT|A Bacillus stearothermophilus

Gene Protein Sequence:
MSRTRARVCLPVKADAYGHGACDVAQAALSCGVHSFAVACVQEASQLRAA
GVRAPILCLSTPTAEEISSLIEHRVHTVISERAHIALIARALRQSADTGA
TCGVHVKIDTGMGRIGCAPDEACALVQMVCATPGLHLEGVCTHFSVADSV
RAEDLQYTEMQRAHFMHCVQYIRKSGISIPLVHAANSAALLCHPRAHFDM
VRPGLLAYGYAPESVHPAVRSVFLPVMELVTQVRAIKKIPAGAYVSYQRL
WRAHTETHVGILPIGYADGVMRALSPGLQVCIGGKWYPVVGAICMDQCVV
DLGTPLRVTVGDRVTLFGPQDAGGPGQGADVLASHAGTIPYELLCAIGKR
VERVYIR

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGCCGTACACGCGCGCGTGTGTGTCTACCTGTTAAGGCGGACGCGTA
TGGACACGGTGCGTGTGACGTCGCACAGGCGGCGCTTTCGTGCGGGGTGC
ACTCGTTCGCCGTTGCATGTGTGCAAGAAGCGTCGCAACTGCGTGCGGCA
GGTGTTCGCGCGCCGATTTTGTGTTTAAGTACTCCAACTGCTGAAGAGAT
TTCTAGTCTTATTGAGCATCGTGTGCACACCGTGATTTCTGAGCGCGCGC
ATATTGCCCTTATCGCACGCGCGCTCCGTCAGTCTGCTGATACGGGTGCC
ACGTGTGGGGTACACGTAAAGATTGATACCGGAATGGGGAGAATCGGCTG
TGCGCCGGATGAGGCCTGTGCGCTCGTGCAGATGGTGTGCGCAACACCGG
GTCTCCATCTTGAGGGGGTATGTACGCATTTTTCTGTCGCGGATTCTGTG
CGTGCTGAGGACCTGCAGTACACTGAGATGCAACGTGCACATTTTATGCA
TTGCGTACAGTACATACGGAAAAGTGGCATATCGATTCCATTGGTGCATG
CGGCAAACTCTGCAGCGCTGTTGTGCCATCCGCGGGCACACTTCGACATG
GTGCGTCCGGGATTGTTGGCATACGGCTATGCCCCTGAGTCTGTGCATCC
TGCTGTGCGCAGTGTGTTCCTTCCCGTCATGGAGCTTGTTACCCAAGTCC
GTGCAATCAAAAAAATACCTGCAGGCGCGTACGTTTCTTACCAGCGCTTG
TGGCGTGCGCATACAGAAACACATGTAGGTATTCTGCCTATCGGATATGC
AGACGGAGTTATGCGCGCGCTGTCGCCGGGTTTGCAGGTGTGCATTGGGG
GGAAGTGGTATCCGGTGGTGGGGGCAATTTGCATGGACCAGTGTGTAGTG
GACCTAGGTACCCCGCTGCGTGTGACAGTTGGAGATAGGGTGACACTTTT
CGGTCCTCAGGACGCAGGTGGCCCAGGACAGGGGGCAGATGTGCTCGCCT
CGCATGCAGGCACCATTCCCTATGAGCTTTTGTGCGCGATTGGTAAGCGT
GTCGAACGGGTGTACATCCGG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy