Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap tRNA-Val-2 IGR480 IGR481 IGR482 IGR484 IGR485 IGR486 IGR487 IGR479 IGR483 IGR488 TP0676 ftsJ, - TP0682 TP0677 gcp, - TP0680 alr, - TP0681 gltX, - TP0673 TP0679 TP0674 TP0678 TP0675 ispB, - TP0683 mglB, - TP0684 TP0676 ftsJ, - TP0682 TP0677 gcp, - TP0680 alr, - TP0681 gltX, - TP0673 TP0679 TP0674 TP0678 TP0675 ispB, - TP0683 mglB, - TP0684 Type: tandem, Name:  - 262 Type: tandem, Name:  - 297 Type: tandem, Name:  - 315 ftsJ, - TP0682 TP0677 gcp, - TP0680 alr, - TP0681 gltX, - TP0673 TP0676 TP0679 TP0674 TP0678 TP0675 ispB, - TP0683 mglB, - TP0684
* Calculated from Protein Sequence

Gene ID: TP0680

DNA Molecule Name:
1  

Genbank ID:
3322977

Gene Name:
gcp  

Definition:
sialoglycoprotease (O-sialoglycoprotein endopeptidase)

Gene Start:
744967

Gene Stop:
743912

Gene Length:
1056

Molecular Weight*:
38118

pI*:
7.59

Net Charge*:
4.19

EC:
3.4.24.57  

Functional Class:
Translation; Degradation of proteins, peptides, and glycopeptides  

Pathway: pathway table
Miscellaneous Enzymes

Comment:
This protein is a neutral metalloprotease that cleaves specifically
O-sialoglycoproteins such as glycophorin A.

Reaction:
HYDROLYSIS OF O-SIALOGLYCOPROTEINS; CLEAVES 31-ARG-|-ASP-32 BOND IN
GLYCOPHORIN A. DOES NOT CLEAVE UNGLYCOSYLATED PROTEINS, DESIALYLATED
GLYCOPROTEINS OR GLYCOPROTEINS THAT ARE ONLY N-GLYCOSYLATED.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to sialoglycoprotease.
For example residues 1-335 are 43% similar to sialoglycoprotease of
Borrelia burgdorferi,(AE001176).

COGS Summary:  COGS Search
BeTs to 17 clades of COG0533
COG name: Metal-dependent proteases with possible chaperone activity
Functional Class:  O
The phylogenetic pattern of COG0533 is amtkYQvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 3-16, 40-51, 73-112, 165-204, 130-139, 150-180, 206-219,
266-276, and 296-306 represent significant (100%) hits to blocks
BL01016A,B,C,D,E,F,G,H, Glycoprotease family proteins.

ProDom Summary:  Protein Domain Search
Residues 43-112 are 55% similar to o-sialoglycoprotein endopeptidase
of GCP_HAEIN. Residues 3-37, 115-167, and 176-275 also support this
match.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 2 to 281 (E-value = 1.4e-93) place TP0680 in the Peptidase_M22 family which is described as Glycoprotease family (PF00814)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
80  
114

PDB Hit:
none

Gene Protein Sequence:
MNVLGIETSCDETAVAIVKDGTHVCSNVVATQIPFHAPYRGIVPELASRK
HIEWILPTVKEALARAQLTLADIDGIAVTHAPGLTGSLLVGLTFAKTLAW
SMHLPFIAVNHLHAHFCAAHVEHDLAYPYVGLLASGGHALVCVVHDFDQV
EALGATIDDAPGEAFDKVAAFYGFGYPGGKVIETLAEQGDARAARFPLPH
FHGKGHRYDVSYSGLKTAVIHQLDHFWNKEYERTAQNIAAAFQACAINIL
LRPLARALQDTGLPTAVVCGGVAANSLLRKSVADWKHARCVFPSREYCTD
NAVMVAALGYRYLIRGDRSFYGVTERSRIAHFSKRGGDRLAAQRSAASQP
LF

Gene Nucleotide Sequence:  Sequence Viewer
GTGAATGTCCTCGGAATTGAGACCTCTTGTGATGAGACTGCAGTTGCAAT
TGTAAAAGATGGCACGCACGTGTGCAGCAATGTTGTGGCTACGCAAATTC
CTTTTCATGCGCCGTATCGTGGCATTGTCCCAGAACTTGCAAGTCGCAAG
CACATTGAGTGGATTTTGCCAACGGTGAAAGAGGCGCTTGCACGCGCTCA
GCTGACGCTTGCTGATATCGATGGCATCGCCGTAACACATGCACCTGGGC
TGACCGGATCTCTCCTGGTAGGCCTGACGTTTGCGAAAACACTCGCATGG
TCAATGCACCTTCCTTTCATTGCGGTTAATCACCTTCATGCACACTTTTG
TGCCGCGCACGTGGAGCACGATCTGGCATATCCCTACGTGGGCTTGCTGG
CGTCTGGAGGACATGCGCTCGTATGTGTTGTGCACGATTTTGATCAGGTA
GAAGCGCTTGGCGCAACGATCGACGACGCTCCCGGGGAAGCCTTTGATAA
GGTTGCAGCCTTTTATGGCTTTGGATATCCGGGAGGCAAGGTAATTGAAA
CGTTAGCAGAACAGGGTGACGCGCGTGCCGCGCGTTTTCCGCTTCCTCAT
TTTCACGGAAAAGGGCATCGGTATGATGTATCATATTCAGGATTGAAGAC
AGCAGTTATTCATCAGCTCGATCACTTTTGGAACAAGGAATACGAGCGCA
CTGCGCAGAACATTGCTGCGGCGTTTCAAGCGTGTGCAATCAACATCTTG
CTCCGTCCGCTTGCGCGCGCATTACAGGATACAGGGCTGCCAACGGCAGT
AGTGTGCGGAGGTGTTGCAGCAAACAGTTTGCTCAGAAAATCTGTAGCGG
ACTGGAAGCATGCGCGGTGTGTGTTCCCTTCGCGTGAGTACTGTACAGAC
AACGCGGTGATGGTTGCTGCGCTCGGGTACCGCTATTTGATCCGTGGTGA
TAGGAGTTTCTATGGGGTAACAGAGCGTTCGCGCATTGCGCACTTCAGTA
AGCGCGGGGGAGATCGTCTCGCTGCACAGAGAAGCGCTGCTTCTCAGCCT
CTTTTT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy