Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap tRNA-Val-2 tRNA-Arg-5 IGR476 IGR480 IGR481 IGR482 IGR477 IGR478 IGR475 IGR479 IGR483 TP0676 TP0677 TP0671 ddlA, - TP0670 glyS, - TP0672 gltX, - TP0673 dnaE, - TP0669 TP0679 TP0674 TP0678 TP0675 TP0676 TP0677 TP0671 ddlA, - TP0670 glyS, - TP0672 gltX, - TP0673 dnaE, - TP0669 TP0679 TP0674 TP0678 TP0675 Type: tandem, Name:  - 297 Type: tandem, Name:  - 315 TP0677 TP0671 ddlA, - TP0670 glyS, - TP0672 gltX, - TP0673 dnaE, - TP0669 TP0676 TP0674 TP0678 TP0675 TP0679
* Calculated from Protein Sequence

Gene ID: TP0673

DNA Molecule Name:
1  

Genbank ID:
3322975

Gene Name:
gltX  

Definition:
glutamyl-tRNA synthetase

Gene Start:
739667

Gene Stop:
738057

Gene Length:
1611

Molecular Weight*:
59830

pI*:
7.68

Net Charge*:
5.42

EC:
6.1.1.17  

Functional Class:
Translation; Amino acyl tRNA synthetases  

Pathway: pathway table
Metabolism of cofactors, vitamins, and other substances; Porphyrin and chlorophyll metabolism
Metabolism of macromolecules; Aminoacyl-tRNA biosynthesis

Comment:
Reaction:
ATP + L-GLUTAMATE + TRNA(GLU) =
AMP + PYROPHOSPHATE + L-GLUTAMYL-TRNA(GLU).

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to glutamyl-tRNA synthetases.
For example residues 1-520 are glutamyl-tRNA synthetase of Borrelia
burgdorferi,(AE001142).

COGS Summary:  COGS Search
BeTs to 17 clades of COG0008
COG name: Glutamyl- and glutaminyl-tRNA synthetases
Functional Class:  J
The phylogenetic pattern of COG0008 is amtkYqVcEbrHUJgpolinX
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 185-274 are 60% similar to glutamyl-tRNA synthetase of
SYE_THETH. Residues 6-71, 94-184, 211-259, and 275-346 also
support this match.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 2 to 339 (E-value = 2.2e-124) place TP0673 in the tRNA-synt_1c family which is described as tRNA synthetases class I (E and Q), catalytic domain (PF00749)

PDB Hit:
gi|1311358|pdb|1GLN| Mol_id: 1; Molecule: Glutamyl-Trna Synthetase; Chain: Null

Gene Protein Sequence:
MEVRVRYAPSPTGLQHIGGIRTALFNFLFARAHAGVFVLRVEDTDRSRCT
AAFEQNLYDTLRWLGVSWDEGGGCPETAVKQGARGDGRSVAHAGGAYGPY
TQSARTDLYRAQVARLVETGQAYYCFCDASRLERVRKIRTLNRMPPGYDR
HCRELLPEEVRECLASGVPHVIRFKVPLEGSTHFRDALLGDIEWQNEEIN
PDPILLKSDGFPTYHLANVVDDHAMRITHVLRAQEWVPSTPLHLLLYRAF
GWQPPLFCHLPMVMGADGHKLSKRHGATSCDEFRNAGYLPEALLNYVAML
GCSYGEGQDLFTREQLCAHFSLSRLNKSPAVFDYKKLAWFNGQYIRAKSD
EQLCALVWPFIANAGVCGHIPADVEAGAVRTRRFADEAPCAPTEAQRSML
MRVIPLIKERLRFLTDAPELVRCFFQEPSLPEQGVFVPKRLDVAQVRAVL
VRARGLVHEIVSASEPDVEVLLRAEAEKFGIKLGDFLMPIRVALTGATVS
APLVGTIRILGASRSCARIEHVIRERFSDDSQGVGGG

Gene Nucleotide Sequence:  Sequence Viewer
GTGGAGGTGAGAGTTCGGTACGCACCGTCTCCGACGGGGCTCCAGCACAT
CGGGGGTATTAGAACTGCTCTCTTCAACTTCTTGTTCGCGCGAGCGCATG
CAGGCGTATTTGTCCTCCGTGTCGAGGATACTGACCGCAGTCGCTGCACT
GCAGCGTTTGAGCAGAACCTTTACGATACGCTCCGTTGGCTTGGGGTCTC
CTGGGATGAGGGGGGAGGGTGCCCAGAAACAGCGGTGAAGCAGGGCGCGC
GGGGGGATGGCCGCTCTGTTGCTCACGCTGGTGGGGCCTATGGCCCTTAC
ACGCAGTCTGCACGGACAGATCTCTACCGCGCGCAGGTGGCGCGGCTCGT
TGAGACAGGGCAGGCGTATTATTGTTTTTGCGATGCGTCGCGGCTCGAGC
GCGTTCGTAAGATCCGTACGCTCAACAGGATGCCCCCCGGTTATGACCGG
CATTGCCGCGAGCTCCTGCCTGAAGAAGTTCGGGAATGTCTCGCATCCGG
GGTTCCACATGTGATCCGCTTTAAGGTCCCCTTGGAAGGGAGTACTCATT
TCCGCGATGCGCTGCTCGGTGATATCGAGTGGCAAAATGAGGAGATCAAT
CCAGACCCGATTTTACTGAAAAGCGACGGGTTCCCCACTTACCATTTGGC
TAATGTGGTAGATGACCATGCTATGCGTATTACGCATGTTTTGCGCGCTC
AGGAGTGGGTTCCCTCCACCCCGTTACACCTTCTGTTGTACCGTGCTTTT
GGCTGGCAGCCCCCGCTCTTCTGTCATCTTCCGATGGTTATGGGGGCAGA
TGGGCACAAGTTGTCAAAGCGGCATGGAGCTACTAGCTGTGATGAGTTCC
GCAACGCGGGGTATTTGCCTGAAGCGTTGCTCAACTATGTTGCAATGCTC
GGTTGCTCGTACGGAGAAGGTCAGGATCTGTTCACGCGAGAGCAGCTGTG
TGCGCACTTTTCTCTGTCGCGTTTAAATAAGTCACCGGCTGTTTTTGACT
ATAAAAAGCTTGCGTGGTTTAACGGTCAATATATCCGTGCAAAAAGTGAC
GAGCAGCTGTGTGCGCTCGTGTGGCCTTTCATTGCAAACGCCGGTGTGTG
TGGCCACATTCCGGCAGATGTGGAAGCAGGAGCTGTGCGCACACGACGTT
TTGCAGACGAGGCGCCGTGTGCGCCTACAGAAGCGCAGCGTTCCATGCTC
ATGCGAGTTATCCCGCTGATTAAGGAGCGGTTGCGGTTTCTAACCGATGC
GCCGGAGTTGGTGCGTTGTTTTTTTCAAGAACCGTCTCTCCCTGAACAAG
GGGTGTTTGTGCCGAAGCGCTTGGATGTTGCGCAGGTGCGCGCGGTACTG
GTGCGCGCCAGGGGCCTGGTGCACGAAATAGTGAGTGCCAGTGAACCGGA
TGTTGAGGTGCTCTTGCGTGCTGAGGCAGAAAAGTTTGGAATAAAACTTG
GTGATTTTCTCATGCCCATTCGCGTTGCGCTCACCGGTGCTACCGTGAGT
GCCCCTCTGGTAGGAACTATCCGCATCCTGGGGGCGTCACGATCCTGTGC
GCGTATTGAACACGTCATTCGTGAACGCTTTTCGGATGACAGTCAAGGAG
TGGGAGGAGGC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy