Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap tRNA-Arg-5 IGR476 IGR480 IGR481 IGR482 IGR477 IGR478 IGR475 IGR479 TP0676 TP0677 TP0671 ddlA, - TP0670 glyS, - TP0672 gltX, - TP0673 dnaE, - TP0669 TP0674 TP0675 TP0676 TP0677 TP0671 ddlA, - TP0670 glyS, - TP0672 gltX, - TP0673 dnaE, - TP0669 TP0674 TP0675 Type: tandem, Name:  - 315 TP0677 TP0671 ddlA, - TP0670 glyS, - TP0672 gltX, - TP0673 dnaE, - TP0669 TP0676 TP0674 TP0675
* Calculated from Protein Sequence

Gene ID: TP0672

DNA Molecule Name:
1  

Genbank ID:
3322974

Gene Name:
glyS  

Definition:
glycyl-tRNA synthetase

Gene Start:
737919

Gene Stop:
736534

Gene Length:
1386

Molecular Weight*:
52666

pI*:
7.44

Net Charge*:
3.46

EC:
6.1.1.14  

Functional Class:
Translation; Amino acyl tRNA synthetases  

Pathway: pathway table
Metabolism of macromolecules; Aminoacyl-tRNA biosynthesis

Comment:
Reaction:
ATP + L-GLYCINE + TRNA(GLY) = AMP + PYROPHOSPHATE + L-GLYCYL-TRNA(GLY).

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to glycyl-tRNA synthetases.
For example residues 1-460 are 52% similar to glycyl-tRNA synthetase
Borrelia burgdorferi,(AE001142).

COGS Summary:  COGS Search
BeTs to 9 clades of COG0423
COG name: Glycyl-tRNA synthetase, class II
Functional Class:  J
The phylogenetic pattern of COG0423 is amtkY-----r---gpol---
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 105-122 represent a significant (96%) but unlikely hit to
block PR00672B, INHIBIN BETA C CHAIN SIGNATURE.

ProDom Summary:  Protein Domain Search
Residues 9-157 are 41% similar to glycyl-tRNA synthetase of SYG_MYCPN.
Residues 163-198, 248-290, 298-327, and 343-443 also support this
match.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 26 to 226 (E-value = 1.1e-68) place TP0672 in the tRNA-synt_2b family which is described as tRNA synthetase class II core domain (G, H, P, S and T) (PF00587)
Residues 365 to 455 (E-value = 8.4e-23) place TP0672 in the HGTP_anticodon family which is described as Anticodon binding domain (PF03129)

PDB Hit:
gi|2392169|pdb|1ATI|A Thermus thermophilus

Gene Protein Sequence:
MEKIVGLCKRRGFVFPSSEIYGGQGGVWDYGPMGIALKNNIAHAWWQDMT
RLHDHIVGLDAAILMHPNVWRTSGHVDHFSDPLVDCTVCKSRFRADQVAV
PSAGGPCPQCGGALTGVRNFNLMFSTHMGPTDERASLLYLRPETAQGIYV
NYKNVLQTTRLKVPFGIAQIGKAFRNEIVTKNFIFRTCEFEQMEMQFFVR
PAEDTHWFEYWCAQRWAFYQKYGVRMNHMRWRTHAAHELAHYARAACDIE
YAFPMGFRELEGVHNRGDFDLTRHAQHSGKDLCYVDPDPNLDAAARRYVP
CVVETSAGLTRCVLMFLCDAYTEEYVQAPNVAFSETTQTADQEGAARTGE
MRIVLRLHPALSPTTVAFLPLVKKDGLVDLARAVRDELREDFACDFDAAG
AIGKRYRRQDEVGTPFCVTVDYQSKEDDTVTVRLRDSMAQRRVSRAFLAE
FLRTEIKHYRRP

Gene Nucleotide Sequence:  Sequence Viewer
ATGGAGAAGATTGTCGGTCTCTGCAAACGGCGTGGCTTTGTGTTTCCATC
TTCAGAAATTTATGGTGGCCAAGGAGGTGTTTGGGACTACGGCCCTATGG
GCATTGCGCTAAAAAACAATATTGCCCATGCCTGGTGGCAAGATATGACA
CGCCTACATGATCATATCGTCGGGCTGGATGCAGCAATCTTGATGCATCC
AAACGTATGGCGGACGTCTGGCCACGTCGATCACTTCAGTGATCCTTTGG
TTGATTGCACGGTGTGTAAAAGTCGCTTTCGCGCGGATCAGGTTGCCGTG
CCGTCTGCCGGGGGACCCTGTCCTCAGTGTGGTGGGGCCCTCACGGGCGT
GCGTAATTTTAACCTCATGTTCAGTACCCACATGGGTCCTACGGATGAGC
GTGCCAGTTTGCTCTACCTGCGTCCTGAAACTGCGCAGGGGATTTATGTA
AATTATAAAAACGTCCTGCAAACTACACGCCTGAAGGTGCCTTTTGGTAT
TGCCCAGATCGGTAAGGCGTTTCGCAATGAGATTGTCACAAAAAACTTTA
TTTTCCGTACGTGTGAATTTGAACAAATGGAAATGCAGTTTTTTGTGCGC
CCCGCAGAGGATACTCACTGGTTTGAGTACTGGTGTGCACAGCGCTGGGC
TTTTTACCAAAAGTACGGGGTGCGTATGAACCACATGCGTTGGCGTACCC
ATGCTGCACATGAGTTGGCTCATTATGCACGGGCTGCCTGTGACATTGAG
TATGCATTCCCTATGGGCTTTAGGGAATTAGAAGGGGTGCATAACCGTGG
TGACTTTGACCTGACGCGCCACGCGCAGCACTCGGGTAAAGACTTGTGCT
ATGTGGATCCTGATCCAAACCTGGATGCGGCAGCGCGTCGGTATGTGCCT
TGTGTCGTTGAAACGTCTGCAGGATTGACGCGCTGCGTACTCATGTTTCT
GTGCGATGCATACACAGAAGAATATGTGCAGGCGCCGAATGTCGCGTTTT
CGGAAACGACACAGACAGCTGATCAAGAAGGTGCTGCACGTACGGGCGAG
ATGCGAATAGTGCTGAGGTTGCACCCTGCGCTTTCTCCCACCACTGTTGC
TTTTTTGCCTTTGGTAAAAAAAGACGGATTGGTTGACCTTGCGCGTGCGG
TGCGCGACGAGCTGCGTGAGGATTTTGCCTGTGATTTTGATGCAGCTGGC
GCGATTGGAAAGCGCTACCGCCGTCAAGACGAGGTGGGTACTCCCTTTTG
TGTCACAGTTGATTATCAGTCAAAGGAAGATGATACGGTTACGGTACGTC
TGCGCGACAGCATGGCACAGCGCCGGGTCTCTCGTGCCTTTCTTGCAGAG
TTTTTGCGCACAGAGATAAAACACTACCGGCGTCCC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy