Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap tRNA-Arg-5 IGR476 IGR480 IGR477 IGR478 IGR475 IGR479 TP0671 ddlA, - TP0670 glyS, - TP0672 gltX, - TP0673 dnaE, - TP0669 TP0674 TP0675 TP0671 ddlA, - TP0670 glyS, - TP0672 gltX, - TP0673 dnaE, - TP0669 TP0674 TP0675 Type: tandem, Name:  - 157 TP0671 ddlA, - TP0670 glyS, - TP0672 gltX, - TP0673 dnaE, - TP0669 TP0675 TP0674
* Calculated from Protein Sequence

Gene ID: TP0671

DNA Molecule Name:
1  

Genbank ID:
3322973

Gene Name:


Definition:
aminoalcoholphosphotransferase

Gene Start:
736500

Gene Stop:
735469

Gene Length:
1032

Molecular Weight*:
38956

pI*:
8.28

Net Charge*:
10.30

EC:
2.7.8.-  

Functional Class:
Fatty acid and phospholipid metabolism  

Pathway: pathway table
Miscellaneous Enzymes

Comment:


Blast Summary:  PSI-Blast Search
Gapped BLAST revealed the N-terminal and middle region had several
significant hits to aminoalcoholphosphotransferases. For example
residues 4-183 are 26% similar to aminoalcoholphosphotransferase
of Schizosaccharomyces pombe,(Z99295).

COGS Summary:  COGS Search
BeTs to 3 clades of COG1183
COG name: Phosphatidylserine synthase
Functional Class:  I
The phylogenetic pattern of COG1183 is amt-y----br-uj---linx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 91-127 represent a significant (100%) hit to block BL00379,
CDP-alcohol phosphatidyltransferases proteins.

ProDom Summary:  Protein Domain Search
Residues 12-223 are 28% similar to sn-1,2-diacylglycerol
ethanolaminephosphotransferase of EPT1_YEAST.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 82 to 245 (E-value = 1.4e-20) place TP0671 in the CDP-OH_P_transf family which is described as CDP-alcohol phosphatidyltransferase (PF01066)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
46  
65
transmembrane  
69  
88
transmembrane  
119  
153
transmembrane  
190  
213
transmembrane  
217  
238
transmembrane  
242  
266
transmembrane  
289  
308
transmembrane  
313  
329

PDB Hit:
none

Gene Protein Sequence:
MSHITSRRSSRMKAYSYAVEDRSLLTPFLYRFCVDPLLRVVPYRVPANLI
TLCANACMLLAFTHAYCGSVGGTYAYWFLVPVLCIVYLVGDCLDGRQARR
TGTGSPLGEYFDHCLDTSVVGLLAGIFVLAFRIREPFLLTCIFFVPAFVQ
ISTLWEKLHRGVMVFARIGSNEMVVLTTLGAYAGSFETLRALFLTPLFFS
CTPAQVCVSVLSTGVCIFSCAVFWRMRVFSCALFLHLSLFFFLCVFSSTY
FPTQIGYITALCTLYHMRYAERLLRVIVQGEGTARVEVLVPLLCGVLFLF
PQTSFWVQRAQCSILALEVGVHFVRFVYAHRCYWHWLNPLPTQE

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCACATATTACATCGCGAAGGAGCTCTCGTATGAAAGCGTATTCTTA
TGCAGTAGAGGATCGCTCGCTTCTCACTCCTTTTCTGTATCGCTTCTGTG
TAGATCCGCTGTTACGCGTGGTGCCGTATCGAGTTCCGGCGAATCTCATT
ACGCTGTGCGCAAACGCCTGTATGCTGCTTGCATTTACCCATGCGTACTG
CGGCTCGGTGGGGGGTACCTACGCGTATTGGTTTCTAGTTCCTGTGCTGT
GTATTGTGTACCTGGTCGGAGATTGTCTTGATGGGCGCCAAGCTCGGAGA
ACGGGAACTGGTAGCCCCTTGGGAGAATATTTTGACCATTGTTTGGACAC
CTCTGTTGTAGGACTGCTGGCAGGAATTTTCGTGCTCGCGTTTCGTATAC
GCGAGCCATTTCTTTTGACGTGTATCTTTTTTGTTCCCGCGTTTGTGCAG
ATTTCAACCCTGTGGGAAAAGCTGCACCGCGGGGTGATGGTGTTTGCGCG
CATTGGGTCAAACGAGATGGTAGTGCTGACCACACTCGGCGCATACGCTG
GGTCGTTCGAAACACTGCGTGCGCTGTTCCTCACGCCGTTGTTTTTTTCC
TGTACTCCTGCACAGGTATGTGTATCAGTGCTCTCAACGGGAGTGTGTAT
TTTTTCGTGTGCGGTGTTTTGGCGTATGCGAGTGTTTTCATGCGCACTTT
TTTTGCATTTATCCCTTTTCTTCTTTCTCTGTGTATTTTCAAGTACGTAT
TTCCCCACGCAGATTGGATATATAACGGCACTGTGCACGTTATATCACAT
GCGATATGCAGAGCGCCTTCTGCGCGTCATTGTACAGGGGGAGGGAACTG
CCCGTGTTGAGGTGTTGGTGCCACTTTTGTGCGGTGTGTTGTTTCTTTTT
CCTCAGACAAGCTTTTGGGTGCAGCGGGCGCAGTGTAGTATTTTGGCACT
TGAGGTGGGGGTGCACTTTGTACGATTTGTGTATGCTCATCGCTGTTATT
GGCATTGGCTGAATCCTCTTCCAACACAGGAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy