Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap tRNA-Pro-2 tRNA-Arg-5 IGR476 IGR477 IGR478 IGR475 IGR479 IGR474 TP0668 TP0671 ddlA, - TP0670 glyS, - TP0672 gltX, - TP0673 dnaE, - TP0669 TP0674 TP0668 TP0671 ddlA, - TP0670 glyS, - TP0672 gltX, - TP0673 dnaE, - TP0669 TP0674 Type: tandem, Name:  - 157 Type: tandem, Name:  - 304 TP0668 TP0671 ddlA, - TP0670 glyS, - TP0672 gltX, - TP0673 dnaE, - TP0669 TP0674
* Calculated from Protein Sequence

Gene ID: TP0670

DNA Molecule Name:
1  

Genbank ID:
3322972

Gene Name:
ddlA  

Definition:
D-alanine--D-alanine ligase

Gene Start:
735464

Gene Stop:
734277

Gene Length:
1188

Molecular Weight*:
42716

pI*:
5.17

Net Charge*:
-10.34

EC:
6.3.2.4  

Functional Class:
Cell envelope; Murein sacculus and peptidoglycan  

Pathway: pathway table
Metabolism of complex carbohydrates; Peptideglycan biosynthesis
Metabolism of complex lipids; Glycerolipid metabolism

Comment:
This protein is involved in cell wall formation. Along with alanine
racemase, it makes up the D-alanine branch of the peptidoglycan
biosynthetic route.

Reaction:
ATP + D-ALANINE + D-ALANINE =
ADP + ORTHOPHOSPHATE + D-ALANYL-D-ALANINE.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to D-alanine--D-alanine
ligases. For example residues 2-363 are 36% similar to DDLA_SALTY,
D-alanine--D-alanine ligase of Salmonella typhimurium,(M20793).

COGS Summary:  COGS Search
BeTs to 11 clades of COG1181
COG name: D-alanine-D-alanine ligase and related ATP-grasp enzymes
Functional Class:  M
The phylogenetic pattern of COG1181 is -----qvcEbrhuj--olinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 3-29, 96-143, 179-218, 269-304, and 312-328 represent
significant (100%) hits to blocks to BL00843A,B,C,D,E, D-alanine-
-D-alanine ligase proteins.

ProDom Summary:  Protein Domain Search
Residues 98-349 are 40% similar to D-alanine--D-alanine ligase of
DDLA_SALTY. Residues 4-46 also support this match.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 2 to 347 (E-value = 3.4e-206) place TP0670 in the Dala_Dala_ligas family which is described as D-ala D-ala ligase (PF01820)
Residues 136 to 353 (E-value = 4.6e-05) place TP0670 in the CPSase_L_D2 family which is described as Carbamoyl-phosphate synthase L chain, ATP binding domain (PF02786)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
234  
325

PDB Hit:
gi|1311190|pdb|2DLN| Mol_id: 1; Molecule: D-Alanine--D-Alanine Ligase; Chain: Null; Ec: 6.3.2.4

Gene Protein Sequence:
MVHVTLLYGGRSAEHDVSVRSARFVARTLCLQHTVMLIGITRRGVWYAQP
ACALEQLCTGTVALSIQEDEKRRVCLVPGGGTAGAFVIAGMPCVTDVVFP
VLHGSYGEDGTVQGLLEMLQVPYVGCGVCASALAMDKVKAKMLWQAAGLP
VLPFVFFRKDAWRMHMQEFVAQLETRLGYPLFVKPAQAGSSVGASAVQTR
APLIPAIEAAFQWDEVVLVERYVRAREIECALSGNGPYTVHGAGEVIAQG
AFYDYEEKYADASVARVLVTAPLETAQYEQITTLALRAYEALGLTGLARV
DFFLLETGEVYVNEVNTMPGFTSISLFPQICQAAGVAPQDLMAQLLSCAR
ERFAARAALSTDLHAHVCAPSVTAAHDPDAQGDDWDQRDSNPLPTA

Gene Nucleotide Sequence:  Sequence Viewer
GTGGTGCATGTGACGCTTTTGTACGGAGGCCGTTCTGCAGAGCACGATGT
TTCTGTACGTTCTGCACGTTTTGTGGCGCGCACGTTGTGCTTACAACACA
CCGTAATGCTCATCGGTATTACCCGTCGTGGCGTGTGGTATGCGCAGCCT
GCGTGTGCATTAGAGCAGTTGTGTACCGGCACTGTCGCGCTCAGTATTCA
GGAAGATGAAAAGAGGCGCGTGTGTCTTGTCCCGGGAGGTGGTACTGCAG
GCGCTTTTGTCATAGCGGGGATGCCGTGTGTCACGGATGTGGTATTCCCC
GTATTGCATGGCAGTTATGGGGAAGATGGTACGGTGCAGGGTTTGCTTGA
GATGCTGCAGGTGCCGTACGTGGGGTGTGGAGTGTGTGCAAGTGCTCTTG
CGATGGATAAGGTAAAGGCAAAGATGCTATGGCAGGCGGCGGGACTTCCC
GTTTTACCGTTTGTCTTTTTCCGTAAAGATGCATGGCGTATGCATATGCA
AGAATTTGTTGCGCAGCTTGAAACACGCCTTGGCTATCCTCTTTTTGTAA
AGCCAGCTCAAGCAGGCAGTTCCGTAGGAGCCAGTGCAGTGCAGACGCGT
GCACCGCTTATCCCTGCGATTGAAGCGGCTTTTCAGTGGGATGAAGTGGT
GTTGGTGGAGCGATATGTGCGCGCGCGAGAAATTGAATGTGCGCTCAGTG
GGAACGGACCCTATACTGTACATGGGGCAGGAGAGGTGATTGCGCAGGGA
GCCTTTTATGACTACGAGGAAAAATATGCTGATGCAAGTGTCGCGCGTGT
ACTCGTTACGGCTCCTCTTGAGACTGCCCAGTACGAACAGATTACCACAC
TTGCCCTGCGCGCATACGAAGCATTAGGACTCACGGGTCTGGCGCGGGTT
GATTTTTTTCTGTTAGAAACGGGAGAAGTATATGTGAACGAAGTAAACAC
GATGCCGGGTTTTACGTCGATATCACTCTTTCCCCAAATATGTCAGGCTG
CAGGTGTTGCACCGCAGGACTTAATGGCACAACTCCTTTCTTGCGCACGA
GAGCGCTTTGCAGCGCGCGCCGCACTGAGCACCGACTTGCACGCCCACGT
GTGTGCGCCCTCGGTGACTGCTGCACATGACCCCGATGCGCAAGGGGACG
ACTGGGACCAGAGGGACTCGAACCCCCTCCCTACTGCT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy