Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap tRNA-Pro-2 tRNA-Arg-5 IGR476 IGR477 IGR473 IGR475 IGR474 TP0666 TP0668 TP0665 TP0671 ddlA, - TP0670 glyS, - TP0672 udk, - TP0667 dnaE, - TP0669 TP0666 TP0668 TP0665 TP0671 ddlA, - TP0670 glyS, - TP0672 udk, - TP0667 dnaE, - TP0669 Type: tandem, Name:  - 157 Type: tandem, Name:  - 304 TP0668 TP0665 TP0671 ddlA, - TP0670 glyS, - TP0672 udk, - TP0667 dnaE, - TP0669 TP0666
* Calculated from Protein Sequence

Gene ID: TP0669

DNA Molecule Name:
1  

Genbank ID:
3322971

Gene Name:
dnaE  

Definition:
DNA polymerase III, subunit alpha

Gene Start:
734120

Gene Stop:
730611

Gene Length:
3510

Molecular Weight*:
132314

pI*:
6.79

Net Charge*:
-3.67

EC:
2.7.7.7  

Functional Class:
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table
Nucleotide metabolism; Purine Metabolism
Nucleotide metabolism; Pyrimidine Metabolism

Comment:
DNA polymerase III is a complex, multichain enzyme responsible for
most of the replicative synthesis in bacteria. The alpha chain is
the DNA polymerase.

Reaction:
N DEOXYNUCLEOSIDE TRIPHOSPHATE = N PYROPHOSPHATE + DNA(N).

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to DNA polymerase III,
subunit alpha. For example residues 3-1068 are 505 similar to DNA
polymerase III, subunit alpha of Borrelia burgdorferi,(AE001159).

COGS Summary:  COGS Search
BeTs to 12 clades of COG0587
COG name: DNA-dependent DNA polymerase III alpha chain
Functional Class:  L
The phylogenetic pattern of COG0587 is -----qvCeBRhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 645-656 represent a significant (96%) hit to block BL00697E,
ATP-dependent DNA ligase AMP-binding site proteins.

ProDom Summary:  Protein Domain Search
Residues 391-912 are 43% similar to DNA polymerase III, subunit alpha
of DP3A_SALTY. Residues 6-390, 130-225, 157-175, 388-441, 391-912,
491-879, 575-598, 888-914, 915-1042, 929-1100, and 1023-1070 also
support the match to DNA polymerase III, subunit alpha.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 7 to 72 (E-value = 2.7e-35) place TP0669 in the PHP_N family which is described as PHP domain N-terminal region (PF02231)
Residues 88 to 219 (E-value = 2e-46) place TP0669 in the PHP_C family which is described as PHP domain C-terminal region (PF02811)
Residues 980 to 1057 (E-value = 1.6e-06) place TP0669 in the tRNA_anti family which is described as OB-fold nucleic acid binding domain (PF01336)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
473  
505
coil-coil  
699  
733

PDB Hit:
none

Gene Protein Sequence:
MARMSFVHLHVHSNYSLLDGASSLQRLVRTAKSLGQEALALTDHGNMFGA
LHFQKVCSAEGIKAIIGCELYVAPESRFDRSEHTIGRRYYHLIVLAKNET
GYRNLMVLSSKAYIEGMYYKPRVDDELLAQHAEGLICLSSCLAGQLPYLL
LQGRKREAEEHARKYRALFGVDNYFIEVQDHGLDEEKKVAPLLIELACRL
GIPLVVTNDVHYAEQEDSVAQDILLCIGTKKNRSDPNRLKFKTDEFYLKS
SEKMAQLFPHYPEMVLNTVRIAQRCNVRIPQPGPLLPLYQIPHEFSSKEH
YIRHLVHRGLYDRYAVVSEEIKARADYELDVIVRMDFVGYFLIVWDFITW
AKEHDIPVGPGRGSGASSIVAYALKITDIDPLRYKLLFERFMNPERISMP
DFDIDFCFERRQEVIEYVRARYGNDNVGQIITFGTLKPKAAIRDVGRVLD
IPLSEVLMITKLMPDDPKLTFKKAYESEQLAQMKQEPRYAELFQIAEKLE
DTNRNTSLHAAGIVIGKTALTDYVPLYKDSKTGKISTQFGMDLIEDCGLV
KMDFLGLKTLTLIQRTQNLVRRKGGKYTTFSISDISDQDPTTFSMLAEGK
SAAVFQFESRGMQGILKRAKPSKMEDLIALNALYRPGPMAFIDQYIESKR
DPGKIKYPDPCLEDILSETYGVIVYQEQVMQVAQRIAGFSLGEADILRRA
MGKKKLAVMQEKKKEFAERAEKQGFDKKHAENIFEILIPFAGYGFNKSHA
TAYSVVAYQTAFLKANFPAEFMAANLSNEINSAEKLPLYMAEAEKMGLSI
QKPDVNASEPYFSVCEGCIVYGLLGIKGLGEQVAFDVFDERIRNGPYTSF
VEVLDRVPATSLNKKNAEIMIKAGCFDRFGVTRASLTAHLDDAMKYVARK
KAVTSSRQASLFDETDLGECSEYTFPVMEEWSQRERLRIEKELMGYYISG
HPLDEYRSVIGEKATLDLGHIENARSENKYLIVGVLNAIHPYTTKSGKNM
AFGSFEDLHGSVDIVVFPVLWEEHRAQFLPETIMGLVGTVDFSKETPAFL
VDSVIDLEQLRFAQVKTILAGSEHRRVSSGEKTPLQKRGVSQEVHIEVSS
HVRAHAQFKSLYEILSAHTGGSGEVFLHMHVDDRTYVVYVPSCKVSATEV
FAQQLKGNESFVQILKECVQ

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCGCGCATGTCTTTTGTTCATTTGCATGTTCACTCAAATTATTCACT
GTTGGATGGAGCTTCTTCATTGCAGCGGCTAGTGCGTACTGCAAAGTCGC
TGGGACAAGAAGCGCTTGCGCTTACCGACCATGGGAATATGTTTGGTGCG
TTGCATTTTCAAAAAGTTTGTTCTGCTGAGGGTATCAAAGCGATTATCGG
ATGTGAGCTCTACGTGGCACCCGAAAGTCGCTTTGATCGCAGTGAGCATA
CTATCGGTCGCAGATACTATCACCTCATCGTGCTTGCTAAGAATGAGACG
GGATATCGAAATCTAATGGTTCTATCCTCCAAAGCCTATATCGAGGGTAT
GTACTACAAACCACGTGTGGATGACGAGCTTCTGGCCCAGCATGCAGAAG
GGCTCATTTGTCTTTCTTCTTGTCTTGCCGGACAGCTTCCTTATCTGTTA
TTGCAGGGCAGAAAAAGGGAGGCAGAAGAACACGCGCGCAAATACCGAGC
GCTCTTCGGTGTAGATAATTACTTTATTGAGGTGCAAGATCATGGACTTG
ATGAAGAGAAGAAAGTAGCACCGCTTTTGATTGAGCTTGCATGTAGGCTC
GGCATTCCGTTGGTGGTTACAAACGACGTGCATTATGCGGAGCAGGAAGA
CTCTGTTGCACAAGACATTCTGCTGTGCATTGGAACGAAGAAGAATCGCT
CCGATCCCAATCGGCTTAAATTTAAAACAGACGAGTTCTATTTAAAGTCT
TCTGAAAAAATGGCTCAGCTGTTTCCCCACTATCCTGAAATGGTGCTGAA
TACGGTGCGCATTGCACAGAGATGTAATGTGCGGATTCCTCAGCCTGGCC
CGCTGCTTCCGCTCTACCAGATTCCTCATGAGTTTTCCAGCAAGGAACAC
TATATTCGCCATCTGGTCCATCGAGGTTTGTATGATCGCTATGCAGTAGT
GAGCGAAGAAATTAAGGCGCGTGCTGATTATGAACTAGATGTTATCGTGA
GGATGGATTTTGTTGGCTACTTTTTGATCGTGTGGGATTTTATTACGTGG
GCAAAGGAGCATGATATTCCTGTTGGTCCGGGGCGGGGGTCTGGAGCAAG
TTCTATTGTTGCATATGCGTTAAAAATTACCGACATCGATCCCCTTAGAT
ATAAGTTGCTTTTTGAAAGATTTATGAATCCTGAGCGTATTTCTATGCCC
GATTTTGACATCGACTTTTGTTTTGAGCGCAGACAAGAAGTGATTGAGTA
TGTGCGTGCGAGATATGGAAATGACAATGTTGGGCAAATTATTACGTTCG
GAACACTTAAGCCAAAGGCGGCGATTCGTGATGTAGGGCGCGTGTTGGAT
ATTCCGCTTTCGGAAGTTTTGATGATTACAAAACTGATGCCTGATGATCC
AAAACTGACTTTTAAAAAAGCGTATGAATCTGAACAATTAGCGCAAATGA
AGCAGGAGCCGCGCTATGCTGAATTGTTTCAAATAGCAGAAAAGCTTGAA
GACACCAATCGAAACACTAGTTTGCATGCAGCAGGTATCGTTATTGGTAA
AACGGCGCTCACTGATTATGTACCGCTCTACAAGGATTCTAAGACGGGAA
AAATTAGTACCCAGTTTGGTATGGATTTAATTGAAGACTGTGGATTAGTG
AAGATGGACTTTCTTGGGCTAAAAACACTTACGCTCATCCAACGGACGCA
GAATCTCGTACGACGTAAAGGGGGTAAGTACACAACGTTTTCGATATCGG
ATATCAGTGATCAGGATCCTACGACTTTTTCTATGTTGGCGGAAGGAAAA
TCTGCTGCAGTGTTTCAGTTTGAAAGTCGCGGTATGCAAGGCATCCTCAA
GCGTGCAAAGCCCAGTAAGATGGAGGATCTAATAGCGTTGAATGCATTGT
ACCGACCTGGGCCGATGGCATTCATTGATCAATATATTGAATCGAAACGT
GATCCTGGGAAAATAAAATACCCTGATCCGTGTTTGGAAGACATCCTTTC
AGAAACATATGGGGTAATAGTATACCAAGAGCAGGTTATGCAGGTGGCAC
AGCGCATTGCAGGTTTCTCGCTGGGAGAAGCAGATATTCTGCGCCGTGCG
ATGGGAAAGAAAAAGCTTGCAGTGATGCAGGAAAAGAAAAAGGAGTTTGC
TGAGCGTGCAGAGAAACAGGGTTTTGATAAAAAGCATGCTGAGAATATTT
TTGAAATTCTTATTCCTTTTGCAGGGTATGGGTTTAATAAAAGTCACGCC
ACTGCATATTCAGTGGTTGCCTATCAAACTGCATTTCTAAAAGCAAATTT
TCCCGCCGAGTTTATGGCTGCGAACCTTTCAAACGAAATTAATTCTGCAG
AAAAATTACCACTCTACATGGCTGAAGCAGAAAAGATGGGTCTGTCCATT
CAGAAACCGGATGTCAATGCTTCTGAACCTTATTTTAGTGTTTGTGAAGG
GTGCATTGTGTATGGGTTGTTGGGTATTAAAGGTTTGGGTGAGCAGGTTG
CGTTTGACGTTTTTGATGAGCGTATTCGCAACGGTCCTTACACCTCCTTT
GTAGAGGTGCTGGATCGAGTTCCTGCAACCTCGTTAAATAAAAAAAATGC
CGAAATAATGATTAAGGCTGGATGTTTTGACCGGTTCGGGGTAACTCGCG
CAAGTCTTACAGCGCACCTCGACGATGCAATGAAATATGTTGCGCGAAAA
AAGGCGGTTACAAGTTCTAGACAAGCAAGCCTTTTTGACGAAACGGATTT
AGGAGAATGTTCTGAATACACCTTTCCGGTTATGGAAGAATGGTCCCAGA
GGGAGAGACTCCGTATAGAGAAGGAACTGATGGGGTATTATATTTCTGGT
CATCCTCTTGATGAATATCGAAGTGTGATAGGAGAAAAGGCGACATTGGA
TTTAGGACATATTGAAAATGCTCGTTCTGAAAATAAATACCTGATTGTGG
GAGTGCTGAATGCTATTCACCCGTATACAACTAAGTCAGGAAAGAATATG
GCTTTTGGCTCTTTTGAGGATCTCCATGGCTCTGTAGACATAGTTGTGTT
TCCTGTGCTGTGGGAGGAGCATCGCGCGCAGTTCTTGCCAGAAACTATTA
TGGGGTTGGTGGGAACTGTAGACTTTTCTAAAGAAACCCCGGCGTTCTTG
GTAGATTCTGTCATTGACTTGGAACAATTACGGTTTGCTCAGGTTAAAAC
TATTCTGGCTGGATCGGAGCATAGGCGTGTATCGTCAGGAGAGAAAACTC
CACTGCAGAAACGTGGCGTTTCGCAGGAAGTGCACATCGAGGTGAGTTCT
CACGTTCGTGCGCATGCACAGTTTAAATCGTTGTATGAGATTTTGAGTGC
ACATACAGGAGGCTCGGGTGAAGTGTTTCTTCACATGCATGTGGATGACC
GTACGTACGTGGTGTACGTTCCTTCGTGTAAGGTATCTGCCACTGAGGTA
TTTGCGCAGCAATTAAAAGGTAATGAGAGTTTTGTCCAAATTCTAAAGGA
GTGCGTGCAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy