Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap tRNA-Pro-2 IGR472 IGR473 IGR470 IGR474 IGR471 TP0666 TP0661 TP0668 TP0665 cbbA,fba, - TP0662 udk, - TP0667 dnaE, - TP0669 flaA-2, - TP0664 flaA-1,tromp2, - TP0663 TP0666 TP0661 TP0668 TP0665 cbbA,fba, - TP0662 udk, - TP0667 dnaE, - TP0669 flaA-2, - TP0664 flaA-1,tromp2, - TP0663 Type: tandem, Name:  - 157 Type: tandem, Name:  - 304 TP0661 TP0668 TP0665 cbbA,fba, - TP0662 udk, - TP0667 dnaE, - TP0669 TP0666 flaA-2, - TP0664 flaA-1,tromp2, - TP0663
* Calculated from Protein Sequence

Gene ID: TP0667

DNA Molecule Name:
1  

Genbank ID:
3322964

Gene Name:
udk  

Definition:
uridine kinase

Gene Start:
729772

Gene Stop:
728108

Gene Length:
1665

Molecular Weight*:
62991

pI*:
7.99

Net Charge*:
8.75

EC:
2.7.1.48  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Salvage of nucleosides and nucleotides  

Pathway: pathway table
Nucleotide metabolism; Pyrimidine Metabolism

Comment:
This protein needs to be evaluated further. It may be two separate
proteins.

This protein is part of the pyrimidine salvage pathway.

Reaction:
ATP + URIDINE = ADP + UMP.
ATP + CYTIDINE = ADP + CMP.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed the C-terminal region had significant hits to
uridine kinase proteins. For example residues 290-485 are 28% similar
to uridine kinase of Bacillus subtilis,(Z99117).

COGS Summary:  COGS Search
BeTs to 8 clades of COG0572
COG name: Uridine kinase
Functional Class:  F
The phylogenetic pattern of COG0572 is ----Y-vceb-h--gpol-n-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 290-305 represent a significant (99%) hit to block PR00364A,
DISEASE RESISTANCE PROTEIN SIGNATURE and a significant (99%) hit to
block PR00819B, CBXX/CFQX SUPERFAMILY SIGNATURE. Residues 288-323
represent a significant (98%) hit to block BL00300B, SRP54-type
proteins GTP-binding domain proteins. Residues 288-313 represent
a significant (97%) hit to block PR00193B, MYOSIN HEAVY CHAIN SIGNATURE.

ProDom Summary:  Protein Domain Search
Residues 290-380 are 26% similar to uridine kinase of URK1_MOUSE.
Residues 349-406 and 438-485 also support matches to uridine kinases.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 290 to 495 (E-value = 3.2e-10) place TP0667 in the PRK family which is described as Phosphoribulokinase / Uridine kinase family (PF00485)

PDB Hit:
none

Gene Protein Sequence:
MGDWMGTFVVSLPGGRREKFSECVPARVLFERFFGTESSVYGLMCNGTPV
LPCQVIGADAVVEPVREDTVLGAALYRRTARLLFATAFHSVYPHVRLFAG
YRVQGGYCYRTEGACADDLDVSLVVRRMKALVAQDAPIHMQYMTRREALN
LFTQWNFPYSHHYILGSYRTVFLTQVLDGFSALFFQPLMASVGRLTVFEV
RMCAEGCLLRFPEGGQRHIISQHNASPQFVVMYRRHRQQEEQTKICSVGQ
LNACIQSGDVATCVDMAEAAHNRQIECCATEIARRDSVRVVSIAGPSGSG
KTTIAKKLSVQLQVLGYDPHVISLDDYYVGIERTPCDAEGNPDFECVEAL
DLPLINKLFLDLLQGKRVALPSYNFKTGKREYRGREVQFGERSLLIIEGI
HGLNDRLISLMNRRVVFRLYVSVFMHLCLDEQHRVSASDGRLLRRVVRDA
QFRGISVEKTLEMWQRVRAGEERYIFPFQHRADMMFNSALVYEFAVLKRR
AQEVLSTVSSACTTYREVRNLRALLEQFCSLSDVHVPGQSILREFIGQSD
FCYCL

Gene Nucleotide Sequence:  Sequence Viewer
GTGGGAGATTGGATGGGCACGTTTGTGGTGTCACTGCCTGGTGGGCGCCG
AGAAAAGTTTTCCGAGTGCGTTCCAGCGCGCGTCCTCTTTGAGCGATTTT
TTGGCACAGAATCGTCTGTGTATGGTTTGATGTGTAACGGTACACCGGTA
CTGCCATGCCAGGTGATAGGCGCCGACGCGGTAGTTGAGCCGGTTCGTGA
GGATACGGTGTTAGGGGCCGCTCTGTACCGTAGGACTGCGCGTTTGCTGT
TTGCCACAGCGTTTCACTCGGTGTATCCGCATGTGCGATTGTTTGCAGGG
TATCGAGTGCAGGGGGGATATTGCTACCGTACCGAGGGTGCGTGCGCAGA
TGACCTGGATGTTTCGTTGGTAGTGCGTAGGATGAAGGCGCTTGTGGCGC
AGGATGCGCCCATTCACATGCAGTATATGACGCGTCGGGAAGCCTTGAAT
CTGTTTACGCAGTGGAATTTTCCATATTCACATCATTATATTCTGGGTTC
GTACCGGACTGTGTTTTTAACGCAGGTACTGGACGGTTTTTCTGCGTTGT
TTTTTCAGCCGCTCATGGCTTCTGTAGGGAGGCTCACCGTCTTTGAGGTG
CGGATGTGTGCTGAGGGTTGTCTGTTGCGTTTCCCTGAAGGTGGACAACG
CCACATCATTTCTCAGCACAACGCGTCGCCACAGTTTGTGGTAATGTATC
GGAGGCATCGGCAGCAAGAAGAACAGACAAAAATATGCTCAGTAGGACAG
TTGAATGCGTGCATTCAGTCTGGTGATGTTGCAACTTGTGTTGACATGGC
TGAGGCGGCGCACAATCGGCAGATTGAGTGTTGTGCCACAGAAATTGCAC
GAAGGGACAGCGTGCGCGTGGTGTCGATAGCAGGACCGTCAGGTTCTGGA
AAGACAACGATTGCAAAAAAACTTTCAGTGCAGCTGCAAGTACTTGGTTA
CGATCCGCATGTGATTAGTCTTGATGATTACTATGTGGGGATTGAGCGCA
CGCCGTGTGACGCGGAAGGTAATCCTGATTTTGAGTGCGTCGAAGCCTTA
GATCTTCCCCTGATTAATAAGTTGTTTTTGGATCTCTTGCAGGGGAAGCG
TGTTGCACTTCCTTCGTATAATTTTAAAACAGGGAAACGAGAGTACCGGG
GGCGGGAAGTACAGTTTGGTGAGCGTTCGCTGCTTATTATTGAGGGCATA
CATGGCTTGAACGATCGGCTCATCTCGTTGATGAACCGGCGAGTTGTATT
TCGGTTGTACGTCTCTGTGTTCATGCATTTGTGCTTGGATGAACAGCACA
GGGTTTCGGCGTCTGATGGAAGGTTGTTGCGGAGGGTTGTGCGCGACGCG
CAGTTTCGCGGTATTTCTGTCGAAAAAACACTTGAAATGTGGCAACGGGT
GCGTGCAGGTGAAGAGCGCTATATTTTCCCTTTTCAGCACCGTGCAGACA
TGATGTTTAACAGTGCATTGGTTTATGAGTTTGCAGTGTTAAAGCGCCGT
GCACAGGAAGTTTTAAGCACGGTTTCTTCTGCTTGTACCACGTATAGGGA
AGTCCGCAATTTGCGTGCCTTGTTGGAGCAGTTTTGTTCGTTGTCTGATG
TGCATGTTCCGGGTCAGTCGATATTAAGAGAATTTATTGGGCAAAGCGAT
TTTTGCTATTGTCTG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy