Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR467 IGR472 IGR468 IGR473 IGR469 IGR470 IGR474 IGR471 TP0666 TP0658 TP0661 TP0665 cbbA,fba, - TP0662 flgL, - TP0659 udk, - TP0667 flgK, - TP0660 flaA-2, - TP0664 flaA-1,tromp2, - TP0663 TP0666 TP0658 TP0661 TP0665 cbbA,fba, - TP0662 flgL, - TP0659 udk, - TP0667 flgK, - TP0660 flaA-2, - TP0664 flaA-1,tromp2, - TP0663 Type: tandem, Name:  - 156 TP0661 TP0665 cbbA,fba, - TP0662 flgL, - TP0659 udk, - TP0667 flgK, - TP0660 csrA, - TP0657 TP0658 TP0666 csrA, - TP0657 flaA-2, - TP0664 flaA-1,tromp2, - TP0663
* Calculated from Protein Sequence

Gene ID: TP0662

DNA Molecule Name:
1  

Genbank ID:
3322961

Gene Name:
cbbA  fba  

Definition:
fructose-bisphosphate aldolase

Gene Start:
725281

Gene Stop:
724286

Gene Length:
996

Molecular Weight*:
36176

pI*:
5.93

Net Charge*:
-5.33

EC:
4.1.2.13  

Functional Class:
Energy metabolism; Glycolysis  

Pathway: pathway table
Carbohydrate metabolism; Fructose and mannose metabolism
Carbohydrate metabolism; Glycolysis / Gluconeogenesis
Carbohydrate metabolism; Pentose phosphate cycle
Energy metabolism; Carbon fixation

Comment:
This enzyme is the sixth step in glycolysis.

Reaction:
D-FRUCTOSE 1,6-BISPHOSPHATE =
GLYCERONE-PHOSPHATE + D-GLYCERALDEHYDE 3-PHOSPHATE.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to fructose-bisphosphate
aldolase proteins. For example residues 7-332 are 42% similar to
class II fructose-1,6-bisphosphate aldolase of Xanthobacter flavus,
(U29134).

COGS Summary:  COGS Search
BeTs to 11 clades of COG0191
COG name: Fructose/tagatose biphosphate aldolases
Functional Class:  G
The phylogenetic pattern of COG0191 is ----yqvcEBrhujgpol---
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 19-62, 86-97, 109-124, 145-158, 183-195, 253-285, 232-264,
173-205, 89-121, and 297-314 represent significant (100%) hits to
blocks BL00602A,B,C,D,E,F,G, Fructose-bisphosphate aldolase class-II
proteins.

ProDom Summary:  Protein Domain Search
Residues 15-317 are 41% similar to fructose-bisphosphate aldolase of
ALF2_RHOSH.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 8 to 332 (E-value = 1.1e-101) place TP0662 in the F_bP_aldolase family which is described as Fructose-bisphosphate aldolase class-II (PF01116)

PDB Hit:
gi|2392284|pdb|1DOS|A Escherichia coli

Gene Protein Sequence:
MTSYKALGLVNTKDLFAKAVKGGYAIPAYNFNNLEQLQAIIQACVETRSP
VILQVSSGARKYANATLLRNMARGAVEYAHELGVDIPIVLHLDHGDSLEL
CIDCIESGFSSVMIDGSALPYDENVALSRKVCEYAHARADYVTVEGELGV
LAGVEDDVVAEKSHYTMPDEVEDFVKKTGVDSLAISIGTSHGRAKFTPEQ
CTRNADGVLIPPPLRFDILAEIEKRIPGFPIVLHGASSVPVEYVREVERY
GGNLPDSVGIPEEQLRKAAKSAVCKVNIDSDGRLAMTAAIRRVLTTKVDE
FDPRKYLGPARDELKKLYMHKNKEVLGSAGRA

Gene Nucleotide Sequence:  Sequence Viewer
ATGACTAGTTACAAGGCACTCGGTTTGGTGAATACCAAGGACCTGTTCGC
AAAGGCAGTAAAGGGCGGATACGCGATCCCTGCGTATAATTTTAACAACC
TGGAACAGCTCCAGGCAATCATACAGGCGTGTGTTGAAACGCGTTCTCCC
GTCATTCTGCAGGTTTCTTCCGGTGCGCGCAAGTACGCAAATGCGACGCT
CCTGCGCAATATGGCACGCGGCGCAGTTGAGTATGCCCATGAGCTCGGCG
TTGATATTCCCATTGTTTTGCATCTGGACCATGGTGACAGCCTAGAGCTG
TGCATTGACTGCATAGAGAGTGGCTTTTCGTCTGTGATGATTGACGGTTC
GGCGTTGCCGTACGACGAGAATGTAGCGCTAAGCAGGAAGGTGTGCGAGT
ATGCCCATGCGCGTGCGGACTATGTCACCGTGGAAGGGGAGCTTGGGGTA
CTCGCTGGTGTGGAAGACGATGTAGTGGCAGAGAAGAGCCACTACACTAT
GCCTGACGAAGTTGAGGACTTTGTGAAAAAAACGGGGGTGGATTCCCTTG
CCATCTCCATCGGAACAAGTCACGGGAGAGCAAAGTTTACGCCAGAGCAG
TGTACGCGCAATGCTGATGGAGTGTTGATCCCCCCTCCGCTACGTTTTGA
CATCCTCGCAGAGATAGAAAAGCGTATTCCTGGCTTTCCCATCGTGCTGC
ACGGTGCTTCGTCTGTGCCCGTTGAGTACGTACGGGAGGTTGAAAGGTAC
GGTGGAAATCTGCCGGATTCTGTGGGTATTCCAGAAGAGCAGTTGCGGAA
AGCTGCCAAAAGCGCGGTGTGCAAGGTGAACATTGACTCGGACGGTCGCC
TCGCTATGACTGCAGCTATACGCAGGGTGCTGACCACCAAGGTAGATGAG
TTTGATCCGAGAAAGTATTTGGGTCCTGCGCGCGATGAGCTTAAGAAGTT
GTACATGCACAAAAACAAGGAAGTGCTCGGAAGCGCCGGCCGCGCA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy