Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR460 IGR464 IGR461 IGR463 IGR462 TP0645 TP0650 TP0646 lysS, - TP0644 TP0648 TP0651 dnaQ, - TP0643 cpsG,manB, - TP0642 TP0645 TP0650 TP0646 lysS, - TP0644 TP0648 TP0651 dnaQ, - TP0643 cpsG,manB, - TP0642 Type: tandem, Name:  - 155 TP0645 TP0646 lysS, - TP0644 TP0648 TP0651 tlyC, - TP0649 serS, - TP0647 tlyC, - TP0649 serS, - TP0647 TP0650 dnaQ, - TP0643 cpsG,manB, - TP0642
* Calculated from Protein Sequence

Gene ID: TP0647

DNA Molecule Name:
1  

Genbank ID:
3322945

Gene Name:
serS  

Definition:
seryl-tRNA synthetase

Gene Start:
709809

Gene Stop:
708532

Gene Length:
1278

Molecular Weight*:
48002

pI*:
7.09

Net Charge*:
0.60

EC:
6.1.1.11  

Functional Class:
Translation; Amino acyl tRNA synthetases  

Pathway: pathway table
Metabolism of macromolecules; Aminoacyl-tRNA biosynthesis

Comment:
Reaction:
ATP + L-SERINE + TRNA(SER) = AMP + PYROPHOSPHATE + L-SERYL-TRNA(SER).

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to seryl-tRNA synthetases.
For example residues 1-421 are 51% similar to seryl-tRNA synthetase
of Borrelia burgdorferi,(AE001133).

COGS Summary:  COGS Search
BeTs to 16 clades of COG0172
COG name: Seryl-tRNA synthetase
Functional Class:  J
The phylogenetic pattern of COG0172 is amtkYqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 138-410 are 42% similar to YHH1_YEAST, a hypothetical protein
with similarity to seryl-tRNA synthetase. Residues 1-98 and 102-137
also support matches to seryl-tRNA synthetases.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 1 to 106 (E-value = 1e-28) place TP0647 in the Seryl_tRNA_N family which is described as Seryl-tRNA synthetase N-terminal domain (PF02403)
Residues 160 to 315 (E-value = 6.8e-44) place TP0647 in the tRNA-synt_2b family which is described as tRNA synthetase class II core domain (G, H, P, S and T) (PF00587)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
30  
68

PDB Hit:
gi|494615|pdb|1SRY|A Thermus thermophilus

Gene Protein Sequence:
MLDYRFIRENVDAVKENVKVRNVHADVDAIVHLYDQRVKLLAELQELQRA
RNENAQTMKSSLDALARSACVETGRALKDRIAHSERLLVQISDQLLSATQ
ALPNMTHMCTPHGRSDSDNLEIKRCGVPPCFSFSPRDHVELARLLDIVDF
EAGKKVSGIKFYYLKREGVLLEQALIMFGLQFLQERGFVPFLTPDIAREG
MVCGLGFNPRGSGSNIYRIEGEHRCLVATAEITLGAYHAGEVLEERSLPR
LYAGLSHCFRKEAGAAGQFSRGLYRVHQFTKLEMFAYCTPSDSECLHERL
RSLEEEIFTALEIPFRVVEVCAGDLGAPAYRKWDLEAWMPGRQGGSWGEV
TSASNCTDYQARRLNVRYKDAEGKKHYVHMLNGTALAISRVLIALLENGQ
DAEGRVRIPQALVPFCGFEYLYPRVL

Gene Nucleotide Sequence:  Sequence Viewer
GTGCTTGATTATCGGTTTATTAGAGAGAACGTGGATGCAGTAAAAGAAAA
TGTGAAGGTCAGGAACGTGCATGCAGATGTGGACGCGATTGTGCACTTAT
ATGATCAGCGCGTAAAGCTTTTAGCAGAGTTGCAAGAATTACAACGTGCG
CGTAATGAGAACGCACAGACGATGAAAAGCTCTTTGGATGCGCTTGCGCG
TTCGGCGTGTGTTGAAACGGGCAGAGCACTAAAAGATCGCATTGCTCACA
GCGAGCGTCTATTGGTACAGATTTCCGATCAGCTTTTGTCTGCAACGCAA
GCGTTGCCAAACATGACGCATATGTGCACTCCCCATGGTCGATCAGACAG
TGATAATCTCGAAATCAAGCGCTGTGGGGTGCCTCCATGCTTTAGTTTTT
CGCCACGTGATCACGTGGAATTAGCGCGCTTGCTGGATATAGTTGATTTT
GAAGCGGGGAAAAAGGTCTCGGGGATAAAGTTTTATTATCTGAAGCGTGA
AGGGGTGCTGCTTGAACAGGCATTGATTATGTTTGGTTTGCAGTTTTTAC
AAGAGCGCGGTTTTGTGCCATTTCTCACTCCTGACATTGCTCGTGAGGGT
ATGGTGTGTGGTTTGGGTTTTAATCCGCGGGGGAGTGGATCGAATATCTA
TCGTATTGAGGGAGAACACCGCTGTTTAGTAGCAACTGCAGAAATTACGC
TGGGGGCATACCATGCAGGCGAGGTTCTTGAAGAGCGGAGTTTACCGCGT
TTATACGCAGGGCTCTCGCATTGTTTTCGTAAAGAGGCTGGTGCTGCAGG
CCAGTTTTCTCGCGGTCTTTATCGCGTGCACCAATTTACCAAACTTGAAA
TGTTTGCGTACTGTACACCGAGTGATTCTGAGTGCCTGCACGAACGCCTG
CGGTCGCTTGAGGAAGAGATTTTTACTGCATTGGAAATTCCTTTTCGTGT
GGTGGAAGTGTGTGCGGGAGATTTGGGTGCGCCTGCGTATCGCAAGTGGG
ATTTGGAGGCGTGGATGCCTGGACGCCAGGGTGGTTCGTGGGGAGAGGTG
ACTTCTGCGTCGAATTGCACAGACTATCAGGCGCGGCGCTTAAATGTCCG
CTATAAGGATGCAGAAGGGAAGAAGCATTATGTACACATGTTGAATGGGA
CGGCGCTTGCAATTTCTCGCGTGTTAATTGCGCTGCTAGAAAATGGGCAG
GATGCGGAAGGTCGCGTGCGCATTCCGCAAGCTTTGGTGCCGTTTTGTGG
TTTTGAGTATCTCTATCCTCGTGTCCTG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy