Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR460 IGR458 IGR461 IGR463 IGR462 IGR459 TP0645 TP0646 hisS, - TP0641 lysS, - TP0644 TP0648 dnaQ, - TP0643 cpsG,manB, - TP0642 mcp-4, - TP0640 TP0645 TP0646 hisS, - TP0641 lysS, - TP0644 TP0648 dnaQ, - TP0643 cpsG,manB, - TP0642 mcp-4, - TP0640 TP0645 TP0646 hisS, - TP0641 lysS, - TP0644 TP0648 serS, - TP0647 serS, - TP0647 dnaQ, - TP0643 cpsG,manB, - TP0642 mcp-4, - TP0640
* Calculated from Protein Sequence

Gene ID: TP0644

DNA Molecule Name:
1  

Genbank ID:
3322943

Gene Name:
lysS  

Definition:
lysyl-tRNA synthetase

Gene Start:
707029

Gene Stop:
705446

Gene Length:
1584

Molecular Weight*:
60891

pI*:
7.00

Net Charge*:
0.00

EC:
6.1.1.6  

Functional Class:
Translation; Amino acyl tRNA synthetases  

Pathway: pathway table
Amino acid metabolism; Lysine biosynthesis
Metabolism of macromolecules; Aminoacyl-tRNA biosynthesis

Comment:
Reaction:
ATP + L-LYSINE + TRNA(LYS) = AMP + DIPHOSPHATE + L-LYSYL-TRNA(LYS).

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to lysyl-tRNA synthetase
proteins. For example residues 6-528 are 51% similar to lysyl-tRNA
synthetase of Borrelia burgdorferi,(AE001167).

COGS Summary:  COGS Search
BeTs to 7 clades of COG1384
COG name: Lysyl-tRNA synthetase class I
Functional Class:  J
The phylogenetic pattern of COG1384 is amtk------------ol--x
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
none

Gene Protein Sequence:
MSICEKSLHWADKVAHKIIKERADCDQYTCASGITPSGTVHIGNFREIIS
VDLVVRALRDQGKSVRFVHSWDDYDVFRRIPDNVPAQDELKQYIRMPITS
VPDPFQQEDSYARHHEREIESALPEVGIYPEYVYQSKQYQAGVYAQEIKI
ALDNRHRIQAILNEYRDEQHKISGTYWPVSVFCTACHKDCTTVDAWDSHW
CLQYHCECGHGEQVDLRQTSAVKLSWRVDWAMRWSKEHVVFEPAGKDHHS
QGGSFDTARLISDHIYHWPAPVSFRYDFIGLKGLPGKMSSSAGKVVGLRD
VLEVYQPEVLRYLFVSTRPNTEFSISFDLDVLKIYEDYDKSERVAWGIHA
AKSEHEFMRHKRIYELSQVRGMPPCISYQVPFRHVCNILQINSGDISAVL
AFFSDIHKDQIERFVRRCQCAWNWIRDAGAPDDFKFTLKEDGVRVPLSAE
ITEALRLIRDTLVPRTDVLSEKELSAELYAVARQIPVGSKELFTALYQVL
IGKNQGPRLAGFMKVIGTQRLHRMLSVY

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGTATCTGTGAAAAGTCACTTCATTGGGCTGACAAGGTTGCGCACAA
GATTATCAAGGAACGTGCTGACTGTGATCAATACACCTGTGCATCGGGGA
TTACCCCCTCAGGAACGGTACATATTGGTAATTTCAGAGAGATTATTTCC
GTTGACCTTGTAGTGCGGGCCCTGCGTGACCAGGGGAAATCAGTGCGCTT
TGTACATTCGTGGGACGATTATGACGTTTTTCGTAGGATTCCCGACAATG
TACCTGCTCAAGATGAATTGAAGCAGTATATTCGCATGCCTATCACTTCA
GTTCCTGATCCCTTTCAGCAGGAAGATAGCTACGCGCGGCACCATGAGCG
GGAAATTGAATCGGCGCTCCCGGAGGTAGGTATTTATCCTGAATACGTTT
ATCAGTCAAAGCAATACCAGGCGGGGGTATACGCACAGGAAATAAAGATT
GCGCTCGACAATCGGCACCGTATTCAAGCGATTTTAAACGAATATCGAGA
TGAGCAGCATAAAATCAGTGGAACGTATTGGCCCGTATCGGTGTTTTGTA
CAGCGTGCCATAAAGACTGCACCACGGTTGATGCGTGGGATAGCCACTGG
TGTCTTCAGTATCATTGCGAGTGTGGGCATGGGGAGCAGGTGGATTTACG
CCAGACGTCTGCGGTAAAACTTAGCTGGCGCGTTGATTGGGCTATGCGGT
GGAGTAAGGAGCATGTGGTATTTGAGCCTGCAGGGAAGGATCATCATTCT
CAGGGAGGTTCTTTTGACACTGCGCGTTTAATTTCTGATCACATTTATCA
CTGGCCTGCGCCTGTTTCTTTTCGTTATGATTTTATTGGATTAAAAGGTT
TGCCTGGGAAGATGTCTTCGTCCGCGGGAAAAGTGGTTGGGCTGCGTGAT
GTGCTTGAAGTATATCAGCCTGAAGTATTGCGATACCTTTTTGTTTCCAC
ACGTCCAAATACCGAGTTTTCCATTAGTTTTGATCTTGATGTTCTTAAGA
TATACGAGGATTACGATAAAAGTGAGCGTGTTGCGTGGGGAATACATGCG
GCAAAAAGCGAACACGAATTTATGCGGCATAAAAGGATCTACGAATTGTC
ACAAGTGCGTGGTATGCCGCCGTGCATTTCGTACCAGGTACCATTCCGGC
ATGTATGCAATATATTGCAAATTAATTCGGGAGATATTTCTGCAGTGCTC
GCGTTTTTCTCTGATATACACAAAGATCAGATAGAGCGCTTTGTGCGCCG
TTGCCAATGTGCGTGGAACTGGATCCGGGACGCTGGTGCACCCGATGACT
TTAAATTTACCCTGAAAGAAGATGGTGTGCGCGTGCCGCTCTCTGCAGAG
ATAACTGAAGCACTGAGACTCATTCGTGATACGCTTGTGCCACGCACTGA
CGTACTCAGCGAAAAGGAACTTTCTGCTGAGTTGTATGCGGTTGCCAGAC
AGATACCTGTTGGCTCGAAGGAACTGTTCACTGCACTATACCAGGTACTG
ATCGGAAAGAATCAGGGGCCACGGCTTGCGGGTTTCATGAAAGTCATCGG
TACACAGCGTTTGCACCGCATGCTTAGCGTATAC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy