Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR460 IGR458 IGR457 IGR461 IGR462 IGR459 TP0645 TP0646 hisS, - TP0641 lysS, - TP0644 dnaQ, - TP0643 cpsG,manB, - TP0642 mcp-4, - TP0640 mcp-3, - TP0639 TP0645 TP0646 hisS, - TP0641 lysS, - TP0644 dnaQ, - TP0643 cpsG,manB, - TP0642 mcp-4, - TP0640 mcp-3, - TP0639 TP0645 TP0646 hisS, - TP0641 lysS, - TP0644 serS, - TP0647 serS, - TP0647 dnaQ, - TP0643 cpsG,manB, - TP0642 mcp-4, - TP0640 mcp-3, - TP0639
* Calculated from Protein Sequence

Gene ID: TP0642

DNA Molecule Name:
1  

Genbank ID:
3322941

Gene Name:
cpsG  manB  

Definition:
phosphomannomutase

Gene Start:
703042

Gene Stop:
704799

Gene Length:
1758

Molecular Weight*:
65129

pI*:
6.85

Net Charge*:
-1.34

EC:
5.4.2.8  

Functional Class:
Central intermediary metabolism; Polysaccharides  

Pathway: pathway table
Carbohydrate metabolism; Fructose and mannose metabolism

Comment:
Reaction:
D-MANNOSE 1-PHOSPHATE = D-MANNOSE 6-PHOSPHATE.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to phosphomannomutase
and to hypothetical proteins. For example residues 38-568 are 37%
similar to YHXB_BACSU, a putative phosphomannomutase of Bacillus
subtilis,(Y14079).

COGS Summary:  COGS Search
BeTs to 17 clades of COG1109
COG name: Phosphomannomutase
Functional Class:  G
The phylogenetic pattern of COG1109 is aMTKYQVCEBRHUJgpOLINx
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
Residues 49-59, 147-156, 302-313, and 534-551 represent significant
(99%) hits to blocks BL00710A,B,C,D, Phosphoglucomutase and
phosphomannomutase phosphoserine signal. Residues 313-324 represent a
significant (96%) hit to block BL01133B, Uncharacterized protein family
UPF0017 proteins.

ProDom Summary:  Protein Domain Search
Residues 207-468 are 34% similar to phosphomannomutase of CPSG_MYCPI.
Residues 96-180, 111-186, 145-164, 302-384, 357-403, and 524-553
also support matches to phosphomannomutase and phosphoglucomutase
proteins.

Paralogs:  Local Blast Search
This protein is paralogously related to TP0413, phosphoglucomutase.
Residues 61-186 are 26% similar to TP0413.

Pfam Summary:  Pfam Search
Residues 45 to 191 (E-value = 1.6e-59) place TP0642 in the PGM_PMM_I family which is described as Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain I (PF02878)

PDB Hit:
none

Gene Protein Sequence:
MHSSQLFERARLYLEEETDPFFAQQVRDLVAQNNIAELEERFLQTLSFGT
AGLRGVVGGGTNRMNPFMIKKITHAIALYLLKTFPEKAARGALRAVIAYD
SRVHSRLFAHTAAHVFLAHDITAYLFSDPRPTPELSYAVQYLTCDVGIVV
TASHNPPQYNGYKVYWNDGAQIAHPHEKNITEEMNAITSVVNLEEKVPVK
RSAPTIIDAEIDEPYCTSIKEKLFRPGLTKETVQSMRIAYTPLHGTGALH
VERILGDMGFSIMTVPEQRLPDGNFPTVSSPNPEDPAALVHACAYADRVH
AEVLMATDPDADRFACAVRNTRGVLQLLTGNQMGALFTDYILLTLQEQNN
MPARPAIVRSVVTSPLSDRIARTYGATCVECLTGFKWICGTAEKISQSGA
YSYVYGFEESYGHNFGIQVRDKDGINAAALCAEMGVYWKLRGMSLIDRLH
QLFRTHGLFCEKTLNKTYAGVAGVSTMNAIMNTLRRQPLTQIARKRVMKV
RDIYLGVEFSPENPAQTSALSFPQSNVLQYFVQDGSIVSIRPSGTEQKIK
CYIIHPLTVSTSIEEAEQAGNMFITAVEQEMGTYLQ

Gene Nucleotide Sequence:  Sequence Viewer
ATGCACTCCAGTCAATTGTTCGAACGTGCTCGTCTTTATCTTGAAGAAGA
AACAGATCCTTTCTTTGCACAGCAGGTACGGGATCTTGTTGCACAGAATA
ATATAGCAGAGCTCGAAGAGCGCTTTTTGCAAACTCTTTCGTTTGGCACC
GCCGGGCTGCGGGGTGTTGTCGGCGGAGGAACAAACAGAATGAACCCCTT
CATGATCAAAAAGATCACGCACGCGATTGCGCTCTATTTACTAAAAACTT
TTCCTGAAAAGGCAGCGCGCGGCGCGCTCCGTGCCGTTATAGCCTACGAC
TCGCGTGTACATTCTCGTCTGTTCGCACACACTGCTGCGCACGTGTTTCT
TGCACATGACATTACCGCCTACCTCTTTTCGGATCCACGCCCGACTCCAG
AACTTTCCTACGCAGTACAGTATCTTACCTGTGACGTGGGCATCGTGGTC
ACCGCATCGCACAACCCACCGCAGTATAACGGATACAAAGTGTACTGGAA
CGACGGGGCACAGATAGCGCATCCTCACGAAAAAAATATCACCGAAGAAA
TGAACGCTATCACGAGTGTCGTGAACCTTGAGGAAAAGGTACCTGTCAAA
CGCAGTGCACCCACGATCATTGATGCAGAAATTGATGAACCGTACTGCAC
CTCTATAAAGGAAAAGCTTTTTCGCCCCGGTCTTACGAAAGAGACCGTCC
AGTCGATGCGTATTGCATACACCCCATTACACGGAACGGGTGCACTCCAC
GTCGAGCGCATACTGGGGGATATGGGGTTCTCCATTATGACCGTGCCTGA
GCAACGGTTGCCAGATGGGAACTTCCCTACGGTGTCGTCTCCTAATCCAG
AAGATCCGGCCGCGTTGGTGCATGCGTGTGCATATGCTGATCGCGTACAT
GCTGAGGTTCTTATGGCGACTGATCCTGACGCAGACCGCTTTGCATGTGC
AGTAAGAAACACCCGCGGTGTGTTGCAGTTGCTCACGGGCAATCAAATGG
GAGCGCTCTTCACTGACTACATTCTGCTAACCCTGCAGGAACAAAACAAT
ATGCCCGCGCGTCCTGCAATTGTACGCTCCGTTGTTACGTCCCCACTTAG
CGACCGTATAGCACGCACATATGGCGCAACGTGTGTAGAGTGCCTTACCG
GATTCAAATGGATATGTGGTACTGCAGAAAAGATTTCACAGTCAGGAGCG
TACTCCTACGTATATGGATTTGAAGAAAGTTACGGACACAATTTTGGTAT
TCAGGTGAGAGACAAAGACGGTATCAACGCCGCAGCGCTCTGTGCAGAAA
TGGGTGTGTACTGGAAGTTGCGCGGAATGAGCCTGATCGATCGCCTTCAC
CAGTTATTCAGGACGCATGGCCTGTTTTGTGAAAAGACGCTGAACAAAAC
CTATGCGGGCGTCGCGGGTGTAAGCACCATGAATGCAATAATGAATACGC
TCAGGAGACAGCCGCTAACCCAAATTGCGCGCAAGCGGGTAATGAAGGTG
AGGGATATATATCTTGGTGTTGAGTTTAGTCCAGAAAATCCTGCGCAGAC
ATCTGCCCTTTCTTTTCCTCAGAGTAACGTGCTGCAGTATTTTGTACAGG
ATGGCAGTATTGTAAGTATACGACCGAGTGGAACAGAACAAAAAATAAAG
TGTTATATCATCCACCCTCTGACCGTCAGTACCTCGATAGAAGAAGCAGA
ACAGGCGGGCAACATGTTTATCACCGCAGTTGAACAAGAGATGGGTACAT
ATCTGCAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy