Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap tRNA-His-1 tRNA-Phe-1 tRNA-Arg-4 IGR460 IGR458 IGR457 IGR461 IGR462 IGR459 IGR456 TP0645 TP0638 hisS, - TP0641 lysS, - TP0644 dnaQ, - TP0643 cpsG,manB, - TP0642 mcp-4, - TP0640 mcp-3, - TP0639 TP0645 TP0638 hisS, - TP0641 lysS, - TP0644 dnaQ, - TP0643 cpsG,manB, - TP0642 mcp-4, - TP0640 mcp-3, - TP0639 Type: tandem, Name:  - 154 TP0645 TP0638 hisS, - TP0641 lysS, - TP0644 dnaQ, - TP0643 cpsG,manB, - TP0642 mcp-4, - TP0640 mcp-3, - TP0639
* Calculated from Protein Sequence

Gene ID: TP0641

DNA Molecule Name:
1  

Genbank ID:
3322940

Gene Name:
hisS  

Definition:
histidyl-tRNA synthetase

Gene Start:
702901

Gene Stop:
701576

Gene Length:
1326

Molecular Weight*:
50188

pI*:
7.81

Net Charge*:
4.69

EC:
6.1.1.21  

Functional Class:
Translation; Amino acyl tRNA synthetases  

Pathway: pathway table
Metabolism of macromolecules; Aminoacyl-tRNA biosynthesis

Secondary Evidence:
Francklyn C, Adams J, Augustine J.
Catalytic defects in mutants of class II histidyl-tRNA synthetase from Salmonella typhimurium previously linked to decreased control of histidine biosynthesis regulation.
J Mol Biol. 1998 Jul;280(5):847-58.
PMID: 9671554

Brenner S, Corrochano LM.
Translocation events in the evolution of aminoacyl-tRNA synthetases.
Proc Natl Acad Sci U S A. 1996 Aug;93(16):8485-9.
PMID: 8710896

Yan W, Francklyn C.
tRNA selection by a class II aminoacyl-tRNA synthetase: the role of accessory domains and inter-domain communication in RNA recognition.
Nucleic Acids Symp Ser. 1995;(33):167-9.
PMID: 8643360

Menguito CA, Papaconstantinou J, Weigel PH.
The histidyl-tRNA synthetase from Streptococcus equisimilis: overexpression in Escherichia coli, purification, and characterization.
Prep Biochem. 1993 Nov;23(4):449-72.
PMID: 8248028

Comment:
Reaction:
ATP + L-HISTIDINE + TRNA(HIS) = AMP + PYROPHOSPHATE + L-HISTIDYL-TRNA(HIS).

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to histidyl-tRNA
synthetases. For example residues 7-397 are 38% similar to SYH_HELPY,
histidyl-tRNA synthetase of Helicobacter pylori,(AE000625).

COGS Summary:  COGS Search
BeTs to 17 clades of COG0124
COG name: Histidyl-tRNA synthetase
Functional Class:? J
The phylogenetic pattern of COG0124 is amtkYQVCeBrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 137-398 are 27% similar to histidyl-tRNA synthetase of
SYH_MOUSE. Residues 33-94, 103-169, 105-133, and 227-337 also
support this match.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 14 to 160 (E-value = 1.8e-36) place TP0641 in the tRNA-synt_2b family which is described as tRNA synthetase class II core domain (G, H, P, S and T) (PF00587)

PDB Hit:
gi|2392059|pdb|1ADJ|A Thermus thermophilus

Gene Protein Sequence:
MRVGSAVSPKVLKGFRDLLPDEEIERALLVEKLTVALRQMGFVPIDTPAL
EYTEVLLRKSEGDTEKQMFRFVDKGGRDVALRFDLTVPLARFVATHYARL
YFPFKRYHFAKVWRGEKPQMGRYREFTQCDFDIVGSDSVCADFEILKSIR
HMLYMAGAEHIRIHVAHRGLFDRFLRALSLSDQAEHILRIIDKRAKMAPH
VLTAQLESLCDPVRVQKIMTYVSAGEVDGVAPSFEHTLSAIETLTGGVSE
ESTRLRKIYELLCAVNIQSSYVFDPSITRGFDYYTGMVCETFLTQLPHIG
SVCSGGRYDHLTALYMKDAVSGVGASIGLDRLYAAFQQLGMSREHVCFVQ
ALIFCQDSALMDVYQKLCSYFAVQVATEVFPDPRKLSQQYAFAEKKGIRW
GIFVEQRNAVVEDCLLVLRDLSTRKDTRLPAHEVRRRMAAEG

Gene Nucleotide Sequence:  Sequence Viewer
GTGCGCGTGGGTTCTGCTGTTTCTCCGAAAGTTTTAAAAGGCTTTCGCGA
TCTTTTACCGGATGAAGAGATTGAGCGTGCATTGCTCGTAGAAAAACTGA
CGGTGGCTTTAAGACAAATGGGTTTTGTACCTATCGATACCCCCGCGTTG
GAGTACACCGAGGTTTTGCTGCGCAAAAGTGAGGGTGACACAGAGAAGCA
GATGTTTCGCTTTGTTGATAAGGGTGGAAGAGATGTGGCCCTCCGCTTTG
ATCTTACGGTGCCGCTTGCGCGGTTCGTTGCAACGCACTATGCGCGTTTG
TATTTTCCTTTTAAGCGCTATCATTTTGCAAAAGTGTGGAGGGGCGAGAA
GCCTCAGATGGGTCGTTATAGAGAATTCACGCAGTGTGATTTTGATATCG
TCGGTTCGGATTCGGTGTGTGCTGACTTTGAAATTCTAAAGTCGATACGG
CACATGTTGTATATGGCTGGTGCAGAACACATACGTATTCACGTTGCGCA
TCGTGGCCTGTTTGATCGTTTTTTGCGTGCTCTTTCTTTGTCTGACCAGG
CTGAGCATATCCTGCGGATAATTGACAAACGTGCAAAGATGGCGCCGCAT
GTGTTGACAGCTCAACTTGAGTCGCTTTGCGATCCAGTTCGTGTGCAAAA
GATTATGACGTATGTAAGTGCGGGGGAGGTGGACGGTGTTGCGCCGTCGT
TTGAACATACATTGTCTGCCATTGAGACATTGACAGGGGGTGTCTCGGAA
GAGAGTACACGGCTTAGAAAAATATATGAGCTACTCTGTGCAGTGAACAT
TCAGTCCTCTTATGTGTTCGATCCATCTATCACGCGTGGTTTTGATTACT
ACACCGGTATGGTGTGTGAAACGTTTTTAACACAGTTGCCTCATATCGGT
TCGGTGTGCTCAGGTGGGCGCTATGACCATCTGACGGCTTTGTACATGAA
GGATGCAGTGAGTGGGGTGGGTGCATCCATTGGGTTGGATCGCTTGTATG
CAGCGTTTCAGCAGTTGGGAATGTCCCGAGAGCACGTTTGTTTTGTGCAG
GCGCTTATCTTCTGTCAGGATAGTGCGCTCATGGATGTGTACCAAAAGCT
GTGTTCATACTTTGCAGTGCAGGTGGCGACGGAAGTCTTCCCTGATCCGC
GGAAGTTGAGCCAACAGTACGCCTTTGCAGAGAAGAAGGGGATTAGGTGG
GGGATCTTTGTTGAACAGCGCAACGCCGTGGTGGAGGACTGCCTGCTCGT
ACTGCGCGACCTTTCTACGCGAAAGGACACACGCCTACCTGCGCACGAAG
TGCGCAGACGCATGGCAGCTGAAGGG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy