Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap tRNA-His-1 tRNA-Phe-1 tRNA-Arg-4 IGR457 IGR454 IGR453 IGR452 IGR451 IGR455 IGR456 TP0638 TP0636 miaA, - TP0637 msrA, - TP0633 trpS, - TP0632 mcp-4, - TP0640 mcp-3, - TP0639 lig, - TP0634 TP0638 TP0636 miaA, - TP0637 msrA, - TP0633 trpS, - TP0632 mcp-4, - TP0640 mcp-3, - TP0639 lig, - TP0634 Type: tandem, Name:  - 259 Type: tandem, Name:  - 152 Type: tandem, Name:  - 153 Type: tandem, Name:  - 154 Type: tandem, Name:  - 260 TP0638 TP0636 miaA, - TP0637 msrA, - TP0633 trpS, - TP0632 mcp-4, - TP0640 mcp-3, - TP0639 lig, - TP0634
* Calculated from Protein Sequence

Gene ID: TP0637

DNA Molecule Name:
1  

Genbank ID:
3322935

Gene Name:
miaA  

Definition:
tRNA delta(2)-isopentenylpyrophosphate transferase

Gene Start:
696645

Gene Stop:
695698

Gene Length:
948

Molecular Weight*:
36161

pI*:
10.75

Net Charge*:
16.85

EC:
2.5.1.8  

Functional Class:
Translation; tRNA modification  

Pathway: pathway table
Miscellaneous Enzymes

Secondary Evidence:
Mangroo D, Limbach PA, McCloskey JA, RajBhandary UL.
An anticodon sequence mutant of Escherichia coli initiator tRNA: possible importance of a newly acquired base modification next to the anticodon on its activity in initiation.
J Bacteriol. 1995 May;177(10):2858-62.
PMID: 7751297

Caillet J, Droogmans L.
Molecular cloning of the Escherichia coli miaA gene involved in the formation of delta 2-isopentenyl adenosine in tRNA.
J Bacteriol. 1988 Sep;170(9):4147-52.
PMID: 3045085

Comment:
This protein catalyzes the first step in the biosynthesis of
2-methylthio-N6-(delta(2)-isopenteyl)-adenosine (MS[2]I[6]A])
adjacent to the anticodon of several tRNA species.

Reaction:
ISOPENTENYL DIPHOSPHATE + TRNA =
PYROPHOSPHATE + TRNA CONTAINING 6-ISOPENTENYLADENOSINE.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to tRNA delta(2)-
isopentenylpyrophosphate transferases. For example residues 47-299
are 305 similar to tRNA isopentenylpyrophosphate transferase of
Bacillus subtilis,(Z99113).

COGS Summary:  COGS Search
BeTs to 12 clades of COG0324
COG name: tRNA delta(2)-isopentenylpyrophosphate transferase
Functional Class:? J
The phylogenetic pattern of COG0324 is ----yqvcebrhuj--olinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 21-42 represent a significant (98%) hit to block PR00449A,
TRANSFORMING PROTEIN P21 RAS SIGNATURE.

ProDom Summary:  Protein Domain Search
Residues 42-125 are 38% similar to tRNA delta(2)-isopentenylpyrophosphate
transferase of MIAA_SYNY3. Residues 217-305 also support this match.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 54 to 309 (E-value = 1.3e-14) place TP0637 in the IPPT family which is described as IPP transferase (PF01715)

PDB Hit:
none

Gene Protein Sequence:
MRLETQALVPYPVRFDRSHHDALVVLGATATGKTALAVALAQKYQGEIIS
ADSRQVYRGLDVGTGKDLALYGSVPYHLIDVCDPYEEYNVFRFQQAVYGI
VPSILRAHKVPIIVGGTGLYLDAVLRQYALVPVERNQALRASLRGASLSH
MRAVYFSLKDSHAVHNKTDLEDPARLMRAIEIAVFHATHPELLQQARETR
PMMRAKVYGIQYPRSMLRARIRARLEQRIRGGLIEEVAALHKGGVSWQRL
EYFGLEYRFTAQYLQGIIATRDEYVDLLFRAISRFAKRQETWFRRMQRLG
VKIHWLVHTENGFVLR

Gene Nucleotide Sequence:  Sequence Viewer
ATGCGGTTGGAAACGCAGGCACTTGTACCGTACCCTGTTCGCTTTGACCG
CAGCCACCATGATGCGCTGGTGGTCCTGGGCGCTACCGCAACAGGTAAGA
CAGCGTTAGCAGTTGCGCTTGCCCAAAAATATCAGGGGGAAATTATTTCC
GCCGATTCGCGGCAGGTGTACCGTGGTCTGGATGTGGGAACGGGAAAGGA
CTTAGCTCTGTACGGGTCGGTCCCCTATCACCTGATAGACGTGTGTGATC
CGTATGAGGAATACAATGTTTTCCGTTTCCAACAGGCAGTATATGGCATA
GTGCCGAGTATACTCCGGGCGCACAAGGTGCCAATTATTGTCGGTGGTAC
GGGTTTGTATCTTGATGCAGTGCTGCGTCAGTACGCGTTGGTACCTGTTG
AAAGAAATCAGGCGCTGCGCGCATCGCTCCGCGGAGCTTCTCTGTCGCAT
ATGCGCGCGGTGTACTTTTCGTTAAAAGACTCCCATGCTGTTCACAACAA
GACAGATTTAGAAGATCCTGCGCGTTTGATGCGCGCTATTGAGATTGCTG
TATTCCATGCAACGCACCCTGAGCTGCTCCAGCAGGCACGGGAAACGCGC
CCGATGATGCGCGCGAAAGTGTATGGCATACAGTATCCACGCTCTATGTT
GCGTGCTCGGATTCGAGCACGCCTCGAGCAGAGAATACGTGGGGGACTGA
TAGAGGAAGTGGCAGCGCTCCACAAAGGCGGGGTTTCCTGGCAGCGTCTG
GAATACTTTGGGTTGGAATATCGCTTCACTGCGCAGTATCTACAAGGGAT
CATTGCTACCCGTGATGAATATGTCGACCTACTTTTTAGAGCTATTAGCA
GATTTGCAAAACGCCAGGAGACGTGGTTCCGACGTATGCAAAGACTCGGG
GTAAAAATTCACTGGCTCGTGCATACGGAAAACGGTTTTGTTCTCCGG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy