Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap tRNA-His-1 tRNA-Phe-1 tRNA-Arg-4 IGR454 IGR453 IGR449 IGR450 IGR452 IGR451 IGR455 IGR456 TP0638 TP0636 miaA, - TP0637 msrA, - TP0633 cheR, - TP0630 trpS, - TP0632 cheB, - TP0631 mcp-3, - TP0639 lig, - TP0634 TP0638 TP0636 miaA, - TP0637 msrA, - TP0633 cheR, - TP0630 trpS, - TP0632 cheB, - TP0631 mcp-3, - TP0639 lig, - TP0634 Type: tandem, Name:  - 259 Type: tandem, Name:  - 152 Type: tandem, Name:  - 153 Type: tandem, Name:  - 154 Type: tandem, Name:  - 260 TP0638 TP0636 miaA, - TP0637 msrA, - TP0633 cheR, - TP0630 trpS, - TP0632 cheB, - TP0631 mcp-3, - TP0639 lig, - TP0634
* Calculated from Protein Sequence

Gene ID: TP0634

DNA Molecule Name:
1  

Genbank ID:
3322933

Gene Name:
lig  

Definition:
DNA ligase

Gene Start:
692381

Gene Stop:
694849

Gene Length:
2469

Molecular Weight*:
91092

pI*:
8.11

Net Charge*:
16.59

EC:
6.5.1.2  

Functional Class:
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table
Signal transduction; Bacterial chemotaxis

Comment:
This protein catalyzes the formation of phosphodiester linkages
between 5'-phosphoryl and 3'-hydroxyl groups in double-stranded
DNA using NAD as a coenzyme and as the energy source for the
reaction. It is essential for DNA replication and repair of
damaged DNA.

Reaction:
NAD(+) + (DEOXYRIBONUCLEOTIDE)(N) + (DEOXYRIBONUCLEOTIDE)(M) =
AMP + NICOTINAMIDE NUCLEOTIDE + (DEOXYRIBONUCLEOTIDE)(N+M).

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to DNA ligase. For
example residues 1-643 are 29% similar to DNLJ_THETH, DNA ligase of
Thermus thermophilus,(M74792).

COGS Summary:  COGS Search
BeTs to 12 clades of COG0272
COG name: NAD-dependent DNA ligase (contains BRCT domain type II)
Functional Class:  L
The phylogenetic pattern of COG0272 is -----qvcEbrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 9-50, 98-137, 178-200, 262-295, 303-342, and 343-368
represent significant (100%) hits to blocks BL01055A,B,C,D,E,F,
NAD-dependent DNA ligase proteins.

ProDom Summary:  Protein Domain Search
Residues 100-372 are 34% similar to DNA ligase of DNLJ_ECOLI. Residues
7-89, 381-536, 563-622, 658-725, and 746-812 also support this match.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 2 to 300 (E-value = 4.9e-24) place TP0634 in the DNA_ligase_aden family which is described as NAD-dependent DNA ligase adenylation domain (PF01653)
Residues 302 to 381 (E-value = 1.7e-35) place TP0634 in the DNA_ligase_OB family which is described as NAD-dependent DNA ligase OB-fold domain (PF03120)
Residues 562 to 642 (E-value = 2.9e-10) place TP0634 in the BRCT family which is described as BRCA1 C Terminus (BRCT) domain (PF00533)
Residues 654 to 729 (E-value = 1.4e-11) place TP0634 in the BRCT family which is described as BRCA1 C Terminus (BRCT) domain (PF00533)
Residues 741 to 819 (E-value = 5.2e-12) place TP0634 in the BRCT family which is described as BRCA1 C Terminus (BRCT) domain (PF00533)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
1  
28
non-globular  
450  
540

PDB Hit:
none

Gene Protein Sequence:
MSTAQRRVQELEKLILHHQDRYYNAESDISDDAFDALWEELARLDPGNPL
LKAIGSDSQRDAVKKRHIVPMGSQHKAADEESFSAWAKKNALQAFLVQHK
LDGVSLELQYERGHFCCALTRGNGIVGDDVTANVRGMRGFVPTLTAEWGP
CGNLPFTGGVRGEVIMHKDIHRSHYPTHANCRNTVNGILKRKDGRGRTHL
HIVCYDAVPGTPGKPFTGSLPFADETEKLAWLARQGFVTVHSHRCANAQE
VVALRSEIMRTRELLPYSIDGLVVKSTDLDFQDAQLPRPKKQIAFKFSTQ
EAITTLRDVQWQTSGVTYTPIGITDPVRLAGTTVKRANLCNPNMLTKLCL
KIGSHVLISKRGEIIPKIEALVSTPAHAQEIHIPTQCTSCNTVLENSGSR
LFCPNVNCPLLSHHRITRWIECLEIKHVGTELIQRLFEEKKVRRIPDLYT
LTCEDLIEIEHVGNATAKKILEAIHHKKEIALQTFIAGFGIEGIGETMGE
KLICAGFDTLEKVLHATTETLESIYQFGTELAKSVVTGIARVKDDMCELL
DRGFVRILAKQQAESPLRGKSFCFSGSLRNGDRATIHRIRALGGVVRTSV
TRDLSYLIFESLSQPYRTAQKLKKEQGVALEIISEDEFCRLLDQASASCT
HTGETVHPLQGKSFYFSGASRSMNHKHAQEKVRALGGDVASSVTAQLDYL
VFYSQSTRYRTACALGIQIISEETLHKLIATAQSPLHTDAHVHAPLHGMS
FCFSGDLDGMTRAQAIALVQRLGGTVKTAVSTQLTYLVSNDPHGQSRKCQ
NAVRCGVRIISEHVFLALCTPGT

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGTACTGCGCAGAGACGTGTTCAAGAACTTGAAAAGCTCATTCTTCA
CCATCAAGACCGCTACTACAACGCGGAGTCTGATATTTCAGATGACGCCT
TTGACGCGCTTTGGGAAGAACTTGCAAGGCTTGATCCTGGAAATCCGCTG
CTTAAAGCAATCGGTTCTGACAGTCAACGTGACGCAGTGAAAAAGCGCCA
CATTGTTCCTATGGGTAGTCAACACAAAGCTGCAGACGAGGAGTCCTTCA
GCGCATGGGCAAAAAAAAATGCATTGCAGGCATTTCTCGTCCAACACAAA
CTCGATGGCGTTAGCTTAGAGTTGCAATACGAGCGCGGTCATTTTTGCTG
TGCGCTCACCCGTGGTAACGGCATTGTCGGAGACGACGTCACTGCTAACG
TACGCGGCATGCGTGGCTTTGTGCCGACCCTCACTGCAGAGTGGGGACCT
TGCGGCAATCTCCCCTTCACGGGGGGTGTTCGTGGCGAAGTCATTATGCA
CAAGGATATACATCGTTCCCACTATCCTACTCACGCAAATTGCCGCAACA
CCGTAAACGGCATCCTAAAGCGAAAGGACGGCCGCGGCCGCACCCACCTC
CATATTGTTTGTTACGACGCAGTACCCGGCACCCCCGGTAAACCGTTCAC
CGGCTCCCTCCCCTTTGCTGATGAAACAGAAAAGCTTGCCTGGCTCGCGC
GCCAAGGTTTCGTGACGGTACATTCGCATCGCTGCGCTAACGCACAGGAA
GTTGTTGCACTCCGATCTGAGATTATGCGCACGCGCGAGCTGTTGCCTTA
CAGCATCGATGGCCTGGTAGTAAAGAGTACCGATCTTGACTTCCAGGACG
CACAACTTCCCAGACCTAAAAAGCAGATAGCCTTTAAGTTCAGTACACAG
GAGGCGATAACCACCTTGCGTGACGTTCAATGGCAAACATCAGGAGTGAC
GTACACGCCCATTGGTATTACCGATCCAGTGCGCCTTGCAGGAACTACGG
TCAAGCGCGCAAATTTATGTAACCCGAATATGCTCACAAAGCTGTGTCTC
AAAATTGGCAGCCACGTTTTAATTTCCAAACGGGGGGAGATTATCCCAAA
AATTGAAGCACTCGTTTCAACCCCAGCACATGCGCAGGAAATCCACATAC
CGACACAGTGTACCAGTTGCAACACAGTGCTGGAAAACAGTGGGAGCAGG
CTTTTTTGTCCTAATGTAAACTGCCCCCTGCTCTCGCATCACCGCATTAC
ACGGTGGATTGAGTGTTTGGAGATCAAGCATGTGGGGACCGAACTCATTC
AGCGTCTTTTTGAAGAAAAAAAGGTACGCCGCATCCCGGACCTCTACACG
CTCACCTGCGAGGATCTCATTGAGATTGAGCACGTCGGCAATGCAACTGC
AAAAAAAATACTCGAAGCTATACACCACAAAAAAGAAATAGCGTTGCAAA
CGTTTATTGCCGGGTTTGGCATCGAGGGGATCGGAGAAACCATGGGAGAA
AAACTTATCTGTGCCGGTTTTGACACACTTGAAAAAGTGCTCCACGCAAC
AACGGAGACACTCGAGTCCATCTATCAGTTTGGAACAGAACTTGCAAAAA
GCGTGGTAACCGGTATTGCACGGGTTAAGGATGATATGTGTGAACTGCTT
GATAGAGGCTTCGTGCGCATTCTTGCCAAGCAGCAGGCAGAGTCGCCACT
CCGGGGAAAAAGCTTTTGCTTCTCAGGCTCCCTCAGAAATGGAGATCGCG
CGACTATACACCGTATACGCGCGCTCGGAGGCGTTGTGAGAACGTCAGTT
ACTCGAGACCTTTCGTACCTAATATTCGAAAGCCTATCACAGCCCTATCG
CACCGCGCAAAAACTAAAAAAAGAACAGGGGGTAGCGCTAGAAATTATTT
CGGAAGACGAGTTTTGCAGGCTTCTAGATCAAGCTTCCGCATCCTGTACC
CATACGGGGGAAACCGTACACCCCTTGCAAGGAAAGAGTTTTTATTTCTC
AGGTGCGTCGCGCAGTATGAATCACAAACATGCTCAAGAAAAAGTGCGCG
CGTTAGGAGGGGATGTCGCATCGTCCGTAACAGCCCAGCTTGACTATCTG
GTGTTTTACAGTCAGTCGACACGTTATCGCACCGCATGCGCGTTGGGAAT
CCAAATTATTTCGGAAGAGACGCTCCACAAGCTTATTGCCACTGCCCAAT
CGCCTTTGCATACGGATGCACACGTGCACGCGCCATTGCACGGCATGAGC
TTCTGCTTCTCTGGCGATCTCGACGGTATGACACGCGCCCAGGCAATCGC
GCTCGTACAACGCCTAGGCGGAACAGTGAAAACGGCTGTCAGTACACAGC
TGACGTATCTGGTGTCAAACGATCCACATGGGCAGTCACGCAAATGCCAG
AACGCTGTTCGGTGTGGCGTGCGTATTATCAGTGAGCACGTCTTTCTCGC
TCTGTGCACCCCGGGGACC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy