Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR454 IGR453 IGR449 IGR450 IGR452 IGR451 IGR448 IGR447 TP0636 miaA, - TP0637 TP0629 msrA, - TP0633 cheR, - TP0630 trpS, - TP0632 cheB, - TP0631 TP0628 lig, - TP0634 TP0636 miaA, - TP0637 TP0629 msrA, - TP0633 cheR, - TP0630 trpS, - TP0632 cheB, - TP0631 TP0628 lig, - TP0634 Type: tandem, Name:  - 260 Type: tandem, Name:  - 152 Type: tandem, Name:  - 153 Type: tandem, Name:  - 259 miaA, - TP0637 TP0636 TP0629 msrA, - TP0633 cheR, - TP0630 trpS, - TP0632 cheB, - TP0631 TP0628 lig, - TP0634
* Calculated from Protein Sequence

Gene ID: TP0632

DNA Molecule Name:
1  

Genbank ID:
3322931

Gene Name:
trpS  

Definition:
tryptophanyl-tRNA synthetase

Gene Start:
690233

Gene Stop:
691243

Gene Length:
1011

Molecular Weight*:
37549

pI*:
9.30

Net Charge*:
7.24

EC:
6.1.1.2  

Functional Class:
Translation; Amino acyl tRNA synthetases  

Pathway: pathway table
Metabolism of macromolecules; Aminoacyl-tRNA biosynthesis

Secondary Evidence:
Zúñiga R, Salazar J, Canales M, Orellana O.
A dispensable peptide from Acidithiobacillus ferrooxidans tryptophanyl-tRNA synthetase affects tRNA binding.
FEBS Lett. 2002 Dec;532(3):387-90.
PMID: 12482597

Chow KC, Wong JT.
Isolation and characterization of the Bacillus subtilis tryptophanyl-tRNA synthetase gene (trpS) conferring 5-fluorotryptophan resistance and temperature sensitivity.
Biochim Biophys Acta. 1996 Nov;1309(1-2):42-6.
PMID: 8950174

Chow KC, Xue H, Shi W, Wong JT.
Mutational identification of an essential tryptophan in tryptophanyl-tRNA synthetase of Bacillus subtilis.
J Biol Chem. 1992 May;267(13):9146-9.
PMID: 1577751

Comment:


Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to tryptophanyl-tRNA
synthetase proteins. For example residues 4-329 are 56% similar to
tryptophanyl-tRNA synthetase of Borrelia burgdorferi,(AE001115).

COGS Summary:  COGS Search
BeTs to 16 clades of COG0180
COG name: Tryptophanyl-tRNA synthetase
Functional Class:? J
The phylogenetic pattern of COG0180 is amtkYqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 8-18 and 193-202 represent significant (99%) hits to blocks
BL00178A,B, Aminoacyl-transfer RNA synthetases class-I proteins.

ProDom Summary:  Protein Domain Search
Residues 63-223 are 46% similar to tryptophanyl-tRNA synthetase of
SYW_CLOLO. Residues 6-46, 4-295 and 271-327 also support this match.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 1 to 284 (E-value = 2.5e-114) place TP0632 in the tRNA-synt_1b family which is described as tRNA synthetases class I (W and Y) (PF00579)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
258  
337

PDB Hit:
none

Gene Protein Sequence:
MLRVLTGDRPTGRLHLGHYAGSLGTRLRIQSEHECFFIIADLHTLTTRHG
RAQLAELPALVRELVLDYLACGIDAQRAVIYLQSAVPEVTELAFIFANLV
TVPRLQRIPSLKEMAQAANLSELPFGLLGYPVLQAADILLARAHLVPVGK
DNESHVELTREVAKRFNRLYGEVFPLPRALLSDCATLVGTDGQAKMSKSL
GNAIFLSDDEETVRRKVRAMYTDPARTRADIPGRVEGNPVFAYHDAFNPN
TDEVAHFKERYRAGRVGDTEVKDALARALNTFLEPIRARRAQLEQQPAYL
ARVLEEGCARMRAEARKTMQRVKEAMGLSARPLVHLP

Gene Nucleotide Sequence:  Sequence Viewer
ATGCTGCGCGTCCTTACCGGAGACCGGCCCACGGGGCGTCTCCACCTCGG
TCACTATGCAGGCTCGCTCGGGACGCGTCTGCGCATACAGTCTGAGCACG
AGTGTTTCTTCATCATCGCGGATCTGCACACGCTCACTACACGCCATGGG
CGTGCACAGCTTGCCGAGCTGCCTGCTCTCGTTCGTGAGCTCGTGCTGGA
CTACCTAGCTTGTGGCATCGACGCGCAGCGTGCGGTCATTTATCTGCAAT
CGGCGGTGCCAGAAGTTACAGAGCTGGCGTTCATTTTTGCGAATCTGGTA
ACGGTGCCGCGTTTGCAGCGCATCCCTTCCTTAAAGGAGATGGCTCAAGC
GGCAAACCTTTCTGAACTTCCCTTTGGTCTTTTGGGATATCCCGTACTTC
AAGCGGCGGACATTCTGCTGGCGCGGGCGCATCTTGTGCCGGTAGGTAAA
GATAATGAAAGTCACGTAGAACTGACGCGCGAAGTTGCAAAGCGTTTCAA
TCGCCTCTATGGGGAGGTCTTTCCATTGCCGCGTGCACTCCTCAGTGACT
GCGCCACTCTCGTGGGAACTGACGGACAAGCGAAAATGTCTAAAAGTTTG
GGGAACGCGATTTTTCTCTCGGACGATGAAGAGACGGTGCGGCGCAAGGT
CCGTGCGATGTACACAGATCCTGCGCGCACCCGGGCAGATATACCAGGAC
GCGTGGAAGGGAATCCGGTGTTTGCGTACCACGATGCGTTCAACCCAAAC
ACGGACGAGGTTGCACATTTTAAAGAGCGGTATCGCGCTGGGCGCGTGGG
AGACACAGAAGTGAAAGACGCTCTTGCGCGCGCCTTGAATACGTTTTTAG
AACCCATCCGCGCACGCCGTGCACAGTTAGAACAGCAGCCTGCGTACCTT
GCACGCGTATTAGAGGAAGGCTGCGCGCGCATGCGTGCTGAAGCACGCAA
AACCATGCAGAGAGTAAAAGAGGCGATGGGTCTTTCTGCACGTCCTCTCG
TTCATCTGCCG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy