Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR449 IGR450 IGR452 IGR451 IGR448 IGR447 TP0629 msrA, - TP0633 cheR, - TP0630 trpS, - TP0632 cheB, - TP0631 TP0628 lig, - TP0634 sbcC, - TP0627 TP0629 msrA, - TP0633 cheR, - TP0630 trpS, - TP0632 cheB, - TP0631 TP0628 lig, - TP0634 sbcC, - TP0627 Type: tandem, Name:  - 153 Type: tandem, Name:  - 150 Type: tandem, Name:  - 151 Type: tandem, Name:  - 152 Type: tandem, Name:  - 259 TP0629 msrA, - TP0633 cheR, - TP0630 trpS, - TP0632 cheB, - TP0631 TP0628 lig, - TP0634 sbcC, - TP0627
* Calculated from Protein Sequence

Gene ID: TP0631

DNA Molecule Name:
1  

Genbank ID:
3322930

Gene Name:
cheB  

Definition:
protein-glutamate methylesterase

Gene Start:
688917

Gene Stop:
690125

Gene Length:
1209

Molecular Weight*:
44087

pI*:
7.69

Net Charge*:
2.62

EC:
3.1.1.61  

Functional Class:
Cellular processes; General  

Pathway: pathway table
Signal transduction; Bacterial chemotaxis

Comment:
This protein is phosphorylated by CheA. It is responsible for removing
the methyl group from the gamma-glutamyl methyl ester residues in the
methyl-accepting chemotaxis proteins (MCP).

Reaction:
PROTEIN L-GLUTAMATE O-METHYL ESTER + H(2)O =
PROTEIN L-GLUTAMATE + METHANOL.

See TP0363, CheA.
See TP0364, CheW.
See TP0365, CheX.
See TP0366, CheY.
See TP0439, CheW.
See TP0630, CheR.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to protein-glutamate
methylesterase proteins. For example residues 7-393 are 37% similar
to CHEB_BACSU, protein-glutamate methylesterase of Bacillus subtilis.

COGS Summary:  COGS Search
BeTs to 7 clades of COG2201
COG name: Chemotaxis response regulator CheB, consists of CheY-like receiver domain and a methylesterase (demethylase) domain
Functional Class:  N,T
The phylogenetic pattern of COG2201 is a--k--v-eb------Ol---
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 7-128 are 45% similar to protein-glutamate methylesterase of
CHEB_BACSU. Residues 213-316 and 317-390 also support this match.

Paralogs:  Local Blast Search
This protein is paralogously related to TP0366, chemotaxis response
regulator (cheY) and TP0519 response regulatory protein (atoC).
Residues 9-124 are 29% similar to TP0366 and residues 8-112 are
28% similar to TP0519.

Pfam Summary:  Pfam Search
Residues 7 to 128 (E-value = 7.9e-26) place TP0631 in the Response_reg family which is described as Response regulator receiver domain (PF00072)
Residues 213 to 396 (E-value = 3.9e-81) place TP0631 in the CheB_methylest family which is described as CheB methylesterase (PF01339)

PDB Hit:
gi|1310893|pdb|1CHD| Cheb Methylesterase Domain Chemotaxis Protein, Serine Hydrolase Mol_id: 1; Molecule: Cheb Methylesterase; Chain: Null; Domain: Methylesterase Domain (C-Terminal Residues 152 - 349); Ec: 3.1.1.61; Engineered: Yes

Gene Protein Sequence:
MKNTNDIAVLIVDDSALMRKVIGKVIEGAPGLSIAGKAMNGRFALDMLER
VQPDVILLDLEMPHMNGLQFLEQRKRLRIDIPVIILSSIAKEGARVTMQC
LELGASDFVTKPFGSESAHLRTVSRKIVDYVTAYGRRYKLLRRTRRCLAM
DTPVERPAGEEDLNCLDTQERASLPSVCARAPARDRASYTITPTEGARQT
RIVPLRESGALQIIAIGVSTGGPSALRHIFAQLDADLPQPVVVVQHMPAG
FTREFAYSLNQVCALEVKEAQEGDLVRRGRVLIAPGDRHLTVERRSLATV
AHINSDEPENGHRPSVDVLFESVARHFENRALGILMTGMGRDGAAQLARL
YTEGSRTIAQDADSCIVYGMPRVACELGAVGEQVSLDDMAATINRYGKVF
ASS

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAAATACTAATGATATTGCTGTTTTAATCGTGGACGATTCTGCGCT
CATGAGAAAGGTTATTGGAAAAGTCATTGAAGGAGCGCCGGGTCTTAGCA
TAGCGGGCAAGGCCATGAATGGGCGCTTTGCGCTTGACATGCTAGAGCGT
GTACAGCCAGATGTCATCTTGCTCGACCTGGAAATGCCGCACATGAACGG
GCTTCAGTTTCTTGAACAGCGGAAACGTCTACGCATTGATATTCCAGTAA
TCATTCTCTCTAGCATTGCAAAAGAAGGTGCACGGGTCACGATGCAATGT
TTGGAGCTGGGGGCAAGTGACTTTGTCACCAAGCCTTTTGGATCTGAGTC
TGCGCATTTGCGCACGGTTTCGCGCAAGATTGTCGATTACGTTACCGCGT
ATGGGAGACGCTACAAGTTGCTGCGCCGCACGCGCCGCTGTCTTGCCATG
GACACACCTGTTGAGAGACCTGCCGGCGAGGAGGACTTGAATTGTTTAGA
TACCCAAGAGCGAGCCTCTCTGCCGTCTGTATGTGCACGTGCGCCCGCGC
GTGACCGTGCATCCTACACAATCACCCCCACAGAGGGAGCGCGCCAAACG
CGCATCGTGCCACTGCGTGAAAGTGGGGCACTGCAGATCATTGCAATCGG
CGTATCAACGGGAGGACCTAGCGCGCTGCGTCATATCTTTGCACAGCTCG
ATGCAGATTTGCCGCAGCCGGTGGTAGTAGTGCAGCACATGCCTGCAGGT
TTCACGCGTGAATTTGCGTACAGTCTTAACCAGGTATGTGCGCTGGAAGT
AAAAGAAGCGCAAGAAGGAGACTTGGTGCGGCGTGGGCGTGTTTTGATTG
CCCCCGGGGATCGCCATCTGACGGTAGAGCGGCGCTCCCTGGCAACTGTT
GCGCACATCAACTCGGATGAACCGGAAAACGGTCACCGACCCAGCGTTGA
TGTGTTATTTGAGTCAGTAGCTCGCCATTTTGAAAACCGCGCATTGGGAA
TTTTAATGACAGGAATGGGAAGGGACGGTGCCGCGCAGCTTGCGCGTTTA
TACACAGAAGGCTCGCGTACAATTGCGCAGGACGCAGATTCGTGCATTGT
ATATGGAATGCCGCGTGTAGCCTGCGAACTTGGAGCAGTTGGCGAACAGG
TGAGTCTTGATGATATGGCAGCGACAATAAATCGCTACGGCAAGGTGTTT
GCCTCTTCC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy