Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR449 IGR450 IGR452 IGR451 IGR448 IGR447 TP0629 msrA, - TP0633 cheR, - TP0630 trpS, - TP0632 cheB, - TP0631 TP0628 lig, - TP0634 sbcC, - TP0627 TP0629 msrA, - TP0633 cheR, - TP0630 trpS, - TP0632 cheB, - TP0631 TP0628 lig, - TP0634 sbcC, - TP0627 Type: tandem, Name:  - 259 Type: tandem, Name:  - 150 Type: tandem, Name:  - 151 Type: tandem, Name:  - 152 TP0629 msrA, - TP0633 cheR, - TP0630 trpS, - TP0632 cheB, - TP0631 TP0628 lig, - TP0634 sbcC, - TP0627
* Calculated from Protein Sequence

Gene ID: TP0630

DNA Molecule Name:
1  

Genbank ID:
3322929

Gene Name:
cheR  

Definition:
chemotaxis protein methyltransferase

Gene Start:
687959

Gene Stop:
688867

Gene Length:
909

Molecular Weight*:
34384

pI*:
9.02

Net Charge*:
9.32

EC:
2.1.1.80  

Functional Class:
Cellular processes; General  

Pathway: pathway table
Signal transduction; Bacterial chemotaxis

Comment:
In E. coli this protein methylates the membrane-bound methyl-accepting
chemotaxis proteins (MCP) to form gamma-glutamyl methyl ester residues
in MCP. The MCP methylation state of the cell is crucial for sensory
responses and adaptations.

Reaction:
S-ADENOSYL-L-METHIONINE + PROTEIN L-GLUTAMATE =
S-ADENOSYL-L-HOMOCYSTEINE + PROTEIN L-GLUTAMATE METHYL ESTER.

See TP0363, CheA.
See TP0364, CheW.
See TP0365, CheX.
See TP0366, CheY.
See TP0439, CheW.
See TP0631, CheB.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to chemotaxis protein
methyltransferases. For example residues 24-299 are 44% similar to
chemotaxis protein methyltransferase CheR of Borrelia burgdorferi,
(AE001146).

COGS Summary:  COGS Search
BeTs to 7 clades of COG1352
COG name: Methylase of chemotaxis methyl-accepting proteins
Functional Class:  N,T
The phylogenetic pattern of COG1352 is a--k--v-eb------OL---
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 92-271 are 34% similar to chemotaxis protein methyltransferase
of FRZF_MYXXA.

Paralogs:  Local Blast Search
This protein is paralogously related to TP0364, purine-binding
chemotaxis protein (cheW). Residues 118-269 are 29% similar to TP0364.

Pfam Summary:  Pfam Search
Residues 28 to 84 (E-value = 5.2e-17) place TP0630 in the CheR_N family which is described as CheR methyltransferase, all-alpha domain (PF03705)
Residues 95 to 288 (E-value = 4.1e-107) place TP0630 in the CheR family which is described as CheR methyltransferase, SAM binding domain (PF01739)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
48  
91

PDB Hit:
gi|2914405|pdb|1AF7| Cher From Salmonella Typhimurium Methyltransferase, Chemotaxis Receptor Methylation Mol_id: 1; Molecule: Chemotaxis Receptor Methyltransferase Cher; Chain: Null; Ec: 2.1.1.80; Engineered: Yes; Biological_unit: Monomer; Other_details:

Gene Protein Sequence:
MTAATEKSDITRSYLTLGKGVRPMSTLSDAEFAAFKTLIYEHSGITFSAL
NRSVLESRIRSRLRELALPSACAYYQQVLASSAELSALLDSVTTNLTRFF
RNKAHFDSFSHYVIPELVKAKRSVGEHSITVWSAGCSTGEEPYTIAMLLK
RYAPAAFSCQVIASDLSLKSLLVARQGYYPRARVSGVPDEYLRAYFRETQ
EGYQINADIRKMVRFDYHNLKHRSMHRNVDVLFCRNVLIYFDETAQKAVI
ERFWDAMSAHSFLFIGHSESLFGMNTKFSFLKTPWGCLCQKNDEGSAHEC
HAR

Gene Nucleotide Sequence:  Sequence Viewer
ATGACGGCTGCGACCGAAAAAAGCGATATAACACGCAGCTACCTGACACT
CGGCAAGGGGGTAAGACCGATGAGCACACTCAGCGATGCGGAATTTGCCG
CGTTTAAAACTCTTATTTACGAGCACAGCGGCATCACCTTTTCTGCACTT
AATCGCTCGGTACTGGAAAGTAGAATTAGATCGCGCCTGCGCGAACTTGC
CCTCCCTTCTGCGTGCGCATACTACCAGCAGGTCCTTGCAAGTAGCGCAG
AGCTTTCTGCACTTCTCGATTCGGTAACCACAAATCTAACGCGTTTTTTC
CGTAACAAAGCCCATTTTGACTCCTTCTCGCACTATGTCATTCCAGAATT
GGTAAAAGCCAAGCGCAGCGTAGGTGAGCATTCCATAACCGTTTGGAGCG
CAGGGTGCTCCACCGGGGAAGAGCCGTACACTATTGCAATGCTGCTGAAA
CGGTATGCGCCCGCTGCGTTCTCATGCCAGGTGATCGCGTCGGATCTCTC
ACTCAAATCGCTTCTCGTTGCACGCCAGGGCTACTACCCGCGCGCACGCG
TCTCTGGAGTACCGGACGAATACCTCCGTGCATATTTTCGCGAAACACAG
GAAGGATATCAAATTAACGCCGATATTAGGAAAATGGTTCGCTTCGATTA
TCATAACTTAAAACACCGTTCCATGCATCGAAACGTCGACGTGCTGTTCT
GCAGAAACGTACTTATTTATTTTGATGAAACAGCCCAAAAGGCGGTTATT
GAGCGATTTTGGGATGCGATGTCTGCTCACTCTTTTCTTTTCATTGGGCA
CTCTGAGTCTCTCTTTGGGATGAATACAAAGTTTTCTTTTCTAAAAACCC
CGTGGGGCTGCCTGTGCCAGAAAAACGATGAAGGGTCAGCGCATGAATGC
CACGCGCGG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy