Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR446 IGR445 IGR448 IGR447 TP0625 TP0629 cheR, - TP0630 sbcD, - TP0626 TP0624 TP0628 dniR,mltD, - TP0623 sbcC, - TP0627 TP0625 TP0629 cheR, - TP0630 sbcD, - TP0626 TP0624 TP0628 dniR,mltD, - TP0623 sbcC, - TP0627 Type: tandem, Name:  - 149 Type: tandem, Name:  - 146 Type: tandem, Name:  - 151 Type: tandem, Name:  - 147 Type: tandem, Name:  - 148 Type: tandem, Name:  - 150 TP0625 TP0629 cheR, - TP0630 sbcD, - TP0626 TP0624 TP0628 dniR,mltD, - TP0623 sbcC, - TP0627
* Calculated from Protein Sequence

Gene ID: TP0627

DNA Molecule Name:
1  

Genbank ID:
3322922

Gene Name:
sbcC  

Definition:
exonuclease SbcC

Gene Start:
682173

Gene Stop:
685313

Gene Length:
3141

Molecular Weight*:
118645

pI*:
7.17

Net Charge*:
4.09

EC:
3.1.-.-  

Functional Class:
Replication; Degradation of DNA  

Pathway: pathway table
Miscellaneous Enzymes

Comment:
In E. coli this protein affects genetic recombination and the
viability of DNA palindromes. SbcC may have a nuclease activity that
is functionally related to one of the nuclease activities of the RecBCD
enzyme.

See TP0626, SbcD

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed severa significant hits to DNA exonucleases.
For example residues 1-1036 are 23% similar to SBCC_ECOLI, exonuclease
SbcC of E. coli,(U73857).

COGS Summary:  COGS Search
BeTs to 11 clades of COG0419
COG name: ATPase involved in DNA repair
Functional Class:  L
The phylogenetic pattern of COG0419 is amtkyqvceb------ol---
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
Residues 368-385 represent a significant (98%) hit to block BL01230C,
RNA methyltransferase trmA family proteins. Residues 1015-1027 represent
a significant (98%) hit to block BL01218A, Uncharacterized protein family
UPF0032 proteins. Residues 28-43 represent a significant (97%) hit to
block PR00364A, DISEASE RESISTANCE PROTEIN SIGNATURE.

ProDom Summary:  Protein Domain Search
Residues 1-1036 are 26% similar to exonuclease SbcC of SBCC_ECOLI.
In addition there were several regions that matched other domains that
are associated with DNA.

Paralogs:  Local Blast Search
This protein is paralogously related to TP0367 chromosome segregation
SMC protein homolog. Residues 401-1018 are 19% similar to TP0367.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
162  
293
non-globular  
296  
381
coil-coil  
382  
409
non-globular  
423  
502
coil-coil  
530  
571
coil-coil  
589  
616
non-globular  
617  
689
coil-coil  
698  
732
non-globular  
918  
1047

PDB Hit:
none

Gene Protein Sequence:
MKPMRLTLHNIGPFVGTHTVDFTALGPIFLVCGKTGSGKTTLFDAIAYAL
YGKPLGTRAEVIRSLRSHYAAPSEAAFATLEFSLGTKIYRVHRTLTCTLS
HRKTEQPEQLYLEQKKGHGWERIACAHKSETECVIHDLLKLNSKEFERVV
MLPQGECAQFLKANSKEKKETLMNLFPVDQYTALMERAKKKSLHAKAVLE
TLRSQLETLCAECMPDTYHERKQTLEAELQHARDALQQTRISHAYYTQKR
EALEAQLKKQQLCKELRARIETYRAQEPVHAETQKRIDRARKAAPLAAHI
KHVTQCEQDAQRIHAEIQEKMRSREQLLMKRAAHVAQQSSIEEQRRLLQT
LHSACIHIEDAHDVATSIRDISCQAHTLTQHIHTLAQQKTTLTQQEQSLC
KELDILQREAGTIDTRTSAFNDLQIQLAHAKKTQELSQRYAELCAAHATC
TAQCEKLEKIHAQKSAYSTRAREQLLQTKEQIHLQETRTHAVVLARLLEH
QEPCPVCGSCIHPNPARQDIDNLEPLTRRMQRIEQTYAQLETSEKDVYHI
LTSERERRASYSAQMQEIQHSFSILTSCDTRSSCDIPNVQKITVRVLDLT
EKLSRAKDMLACAQHALLRKKQPEQDLQDVRAHLQQCSQELAKKETALHA
LQETLTQQRVRIHALSIRLPKELLASNLLAPQKMQHEKESVAYWKEMLAH
CQTLMRELHTHIEEYDREFNEIENASSALGADIAAREDALNHVQKEYMHL
ARTVCCARTEAHFNNNEEVTAALMTDAELSHAAAEIQFFNELRAADTHLL
KTLEAEIGTEIPSDLDELNAQCHTLVKDEENFLSRIEILSATLHTLTHQY
LKYEECSKQLAQKTQESAKLITLSDELNGINQKKIQFDAWALISFLHEIT
AYANIRLQKMSEGRYHLRVADSHVNARGYQGLALLVADAYTGSVRPSATL
SGGETFMASISLALGLADSIQTRSGGIVLDSLFIDEGFGSLDEASLDKAI
GILDEIREGSRMIGIISHVHELRTRIPHKILIKKTNAGSHVMQGDAE

Gene Nucleotide Sequence:  Sequence Viewer
GTGAAGCCGATGCGTCTTACGCTCCACAACATCGGTCCTTTCGTTGGCAC
CCATACAGTTGACTTCACCGCGCTCGGTCCTATTTTTCTAGTGTGTGGGA
AAACAGGTTCAGGAAAAACCACTCTATTCGATGCGATCGCCTATGCCCTG
TATGGGAAACCCCTTGGAACCCGTGCAGAAGTTATCCGCAGTCTGCGCAG
TCATTACGCCGCACCATCAGAAGCTGCATTTGCTACGCTGGAATTTTCAC
TCGGCACTAAAATCTACCGGGTACACCGGACGCTGACTTGCACACTTTCC
CACAGAAAAACAGAGCAACCCGAGCAGCTGTATCTTGAGCAAAAAAAAGG
TCATGGATGGGAGCGTATTGCTTGTGCGCATAAAAGTGAAACTGAATGTG
TTATTCACGATCTTCTCAAACTCAATAGCAAAGAATTTGAGCGCGTGGTT
ATGCTCCCACAGGGAGAATGTGCGCAATTTTTAAAAGCAAATTCAAAAGA
AAAAAAAGAAACGCTGATGAATCTATTTCCTGTTGATCAATATACTGCTC
TTATGGAGCGAGCAAAAAAAAAATCGCTCCATGCCAAAGCAGTGCTTGAA
ACGCTGCGTTCGCAACTTGAAACTCTATGTGCGGAGTGCATGCCCGACAC
ATACCACGAAAGGAAACAAACGCTAGAAGCTGAGTTACAGCACGCACGTG
ACGCACTGCAGCAAACCCGCATCTCCCATGCGTACTATACACAAAAACGT
GAAGCGCTCGAAGCACAGCTAAAAAAACAACAACTTTGTAAAGAGCTGCG
TGCGCGTATAGAAACATACCGCGCGCAAGAACCAGTCCACGCGGAAACTC
AAAAGCGTATTGATCGCGCGCGAAAAGCGGCACCACTTGCTGCGCACATA
AAACACGTCACCCAGTGCGAACAAGATGCACAGCGCATTCATGCAGAAAT
ACAGGAAAAGATGCGTTCACGCGAACAATTGCTCATGAAACGAGCTGCGC
ATGTCGCGCAGCAGTCATCCATTGAAGAACAACGCCGTCTACTACAAACA
CTTCATAGTGCGTGCATTCACATTGAAGACGCGCATGACGTTGCCACGTC
GATACGCGACATATCTTGTCAGGCGCACACACTCACGCAGCATATCCACA
CGCTTGCACAACAAAAAACAACACTTACCCAGCAAGAACAATCGTTGTGT
AAAGAACTGGATATACTGCAAAGAGAAGCGGGTACTATCGATACTCGTAC
ATCTGCCTTTAATGATTTACAAATTCAACTCGCGCATGCAAAGAAGACAC
AAGAATTGTCTCAGCGATATGCCGAGCTCTGTGCGGCTCACGCAACATGC
ACTGCACAATGTGAAAAACTTGAGAAAATACACGCACAAAAAAGCGCGTA
TAGCACACGGGCACGTGAGCAGCTCCTTCAGACAAAAGAACAAATTCATC
TCCAAGAAACCCGGACACACGCGGTAGTACTCGCGCGTCTCTTAGAGCAT
CAAGAACCGTGTCCTGTCTGCGGCTCTTGCATTCATCCGAATCCCGCACG
TCAAGACATAGATAATCTTGAACCGTTAACCCGGCGCATGCAACGCATAG
AACAAACATACGCGCAGCTGGAAACCAGCGAGAAAGATGTGTACCACATC
CTCACCTCTGAGCGTGAGCGACGTGCATCCTACAGTGCACAAATGCAGGA
AATACAGCATTCATTTTCCATTCTTACATCGTGTGATACGCGATCATCCT
GCGATATTCCAAACGTGCAAAAAATTACCGTACGTGTTTTGGATCTCACG
GAAAAATTATCTCGTGCAAAAGATATGCTCGCATGCGCGCAACACGCTTT
ACTGAGAAAAAAACAGCCTGAGCAGGATTTACAGGATGTACGCGCACACC
TGCAGCAATGCTCACAAGAGCTCGCAAAAAAAGAAACAGCACTCCACGCA
TTGCAAGAAACGCTTACACAGCAGCGCGTACGCATTCACGCACTGTCCAT
ACGTTTACCCAAGGAATTGCTTGCATCGAACCTACTTGCTCCGCAAAAGA
TGCAGCATGAGAAGGAGAGTGTCGCCTATTGGAAAGAGATGCTCGCACAC
TGTCAAACCCTTATGCGAGAATTGCACACCCATATTGAAGAATACGACCG
AGAGTTCAATGAGATAGAAAACGCTTCTAGTGCGCTTGGCGCCGACATTG
CAGCGCGAGAAGATGCACTGAACCATGTTCAAAAAGAATACATGCACCTT
GCACGTACCGTGTGTTGCGCACGAACAGAAGCGCATTTCAATAACAACGA
AGAAGTAACCGCCGCTCTTATGACTGATGCTGAACTTTCTCATGCTGCAG
CAGAAATTCAATTTTTCAATGAATTGCGTGCGGCTGACACCCATCTACTG
AAAACACTCGAGGCAGAAATAGGAACAGAAATTCCATCCGATCTTGATGA
ACTGAATGCGCAATGTCATACGTTGGTAAAAGATGAGGAAAACTTTCTCT
CTCGTATTGAAATACTGTCTGCCACGCTACACACACTCACACATCAGTAT
CTTAAATACGAAGAGTGTTCAAAACAGCTTGCACAAAAGACGCAAGAAAG
CGCAAAGCTTATAACTCTTTCAGATGAACTGAATGGGATAAACCAAAAAA
AAATACAATTTGACGCATGGGCACTCATTTCTTTTCTGCACGAAATTACT
GCCTACGCAAACATACGTTTGCAAAAAATGAGTGAAGGACGTTACCATCT
GAGGGTAGCTGACTCGCACGTCAATGCACGAGGATATCAAGGACTTGCGC
TGCTCGTTGCAGATGCGTACACTGGGAGCGTGCGCCCTTCGGCAACACTT
TCAGGAGGCGAAACCTTTATGGCCTCTATCAGTCTTGCACTTGGTCTTGC
AGATTCTATCCAAACCCGATCGGGAGGTATTGTGCTTGACTCGCTGTTCA
TAGATGAAGGATTTGGAAGTTTGGATGAGGCAAGTTTAGATAAGGCAATT
GGCATCTTAGATGAAATCAGAGAGGGAAGTCGCATGATAGGCATCATTTC
TCATGTTCATGAATTGCGCACGCGCATCCCTCACAAAATTCTGATAAAAA
AAACAAACGCAGGATCACACGTAATGCAGGGGGATGCAGAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy