Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR446 IGR445 TP0622 TP0625 sbcD, - TP0626 TP0624 TP0628 dniR,mltD, - TP0623 sbcC, - TP0627 TP0622 TP0625 sbcD, - TP0626 TP0624 TP0628 dniR,mltD, - TP0623 sbcC, - TP0627 Type: tandem, Name:  - 149 Type: tandem, Name:  - 146 Type: tandem, Name:  - 151 Type: tandem, Name:  - 147 Type: tandem, Name:  - 148 Type: tandem, Name:  - 150 TP0622 TP0625 sbcD, - TP0626 TP0624 TP0628 dniR,mltD, - TP0623 sbcC, - TP0627
* Calculated from Protein Sequence

Gene ID: TP0626

DNA Molecule Name:
1  

Genbank ID:
3322921

Gene Name:
sbcD  

Definition:
probable exonuclease SbcD

Gene Start:
681001

Gene Stop:
682173

Gene Length:
1173

Molecular Weight*:
44285

pI*:
6.07

Net Charge*:
-10.55

EC:
3.1.11.-  

Functional Class:
DNA metabolism; DNA replication, recombination, and repair  

Pathway: pathway table

Comment:
In E. coli this protein affects genetic recombination and the
viability of DNA palindromes. SbcD may have a nuclease activity that
is functionally related to one of the nuclease activities of the RecBCD
enzyme.

See TP0627, SbcC

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed the N-terminal and middle region had significant hits to exonuclease SbcD proteins. For example residues 1-252 are 31% similar to SBCD_BACSU, exonuclease SbcD of Bacillus subtilis.

COGS Summary:  COGS Search
BeTs to 12 clades of COG0420
COG name: DNA repair exonuclease
Functional Class: L
The phylogenetic pattern of COG0420 is amtKyqvceBr-----ol---
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 1-11 represent a significant (97%) hit to block BL00785A,
5'-nucleotidase proteins. Residues 301-308 represent a significant
(96%) hit to block BL01152A, Hypothetical hesB/yadR/yfhF family
proteins.

ProDom Summary:  Protein Domain Search
Residues 1-252 are 32% similar to exonuclease SbcD of SBCD_BACSU.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 1 to 221 (E-value = 6.6e-17) place TP0626 in the Metallophos family which is described as Calcineurin-like phosphoesterase (PF00149)

PDB Hit:
none

Gene Protein Sequence:
MKILHTADLHLGKTLHEVSLFASQKKMLGDLCTLLAQDNYAALIIAGDIY
DRCVPSAESVSLFSSFLQNIKRSMPRLPIYLIPGNHDSAQRLSFAQELLK
QQGVFIAQDPEESTRPHLLCHEGETVQLFLLPFLHAGAFSYLDEENTTCL
IHTQSELLQEASRRLQRAVSLDTPSILVAHLFTQKGISCESERPFVGNAV
YADPHWFDFFTYVALGHLHKCQKITERMYYSGSPLPYSFDEANTQKVALS
VEIHCNTKGFPIHVTPLPLEPLIPLRTIRDSFHALYTGDRYLLYQRDFLE
ITLTDPALVHNPIGLLKPRYPGLLSIKQENAFAFDIPPPYSSNEGIAPCT
HHSLRTHFDVFMHEVSPTPDDREKGALFQELFDEMQQEFSS

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAGATCCTGCACACAGCGGACCTACATCTAGGCAAAACACTCCATGA
AGTATCGCTTTTTGCGTCACAGAAAAAAATGCTCGGCGATCTGTGCACCC
TCCTTGCGCAGGACAACTACGCCGCGCTCATCATCGCAGGCGACATCTAT
GACCGCTGTGTACCCTCTGCAGAGAGTGTCAGTCTTTTTAGTTCTTTTTT
GCAAAATATCAAACGGTCCATGCCACGGCTCCCGATATATCTCATCCCCG
GCAACCATGATTCTGCGCAACGTCTCTCCTTTGCCCAGGAGCTACTTAAG
CAGCAGGGAGTATTCATTGCGCAGGATCCTGAAGAGAGCACCCGTCCCCA
TCTCCTCTGTCACGAGGGGGAAACAGTGCAGTTATTTTTACTTCCCTTTC
TCCACGCAGGTGCCTTTTCCTATCTTGATGAGGAAAACACCACTTGTCTC
ATTCACACCCAATCCGAACTCCTTCAAGAAGCCTCGCGTCGCTTGCAGCG
TGCAGTATCGTTGGACACCCCTTCTATCCTTGTCGCACACCTATTTACCC
AAAAAGGTATTAGCTGCGAAAGTGAACGCCCGTTTGTTGGCAATGCCGTT
TACGCTGACCCACACTGGTTTGACTTTTTCACCTATGTTGCACTTGGTCA
TTTACACAAATGTCAAAAAATCACCGAACGCATGTACTATTCCGGATCTC
CTTTGCCCTATTCGTTTGACGAAGCAAATACCCAAAAGGTTGCGCTTTCT
GTAGAGATTCACTGCAACACAAAGGGATTCCCCATCCATGTGACTCCCCT
TCCACTTGAGCCACTTATCCCTCTTCGCACCATACGCGACTCATTCCACG
CACTATATACCGGTGATCGCTATCTCCTTTATCAACGTGATTTTTTAGAA
ATCACCCTGACCGACCCGGCGCTCGTGCACAATCCTATTGGCCTTTTGAA
GCCGCGCTATCCAGGATTGCTCAGTATCAAGCAGGAAAATGCGTTCGCCT
TTGATATACCCCCCCCCTACTCCTCTAACGAGGGGATAGCGCCCTGCACA
CACCACTCATTGCGCACACACTTTGATGTATTTATGCACGAAGTAAGCCC
CACTCCTGATGACAGAGAAAAGGGCGCTCTCTTTCAGGAACTTTTTGACG
AAATGCAACAGGAATTCTCATCG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy