Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR439 IGR437 IGR440 IGR438 IGR442 IGR443 IGR436 IGR441 TP0617 TP0618 TP0619 tprI, - TP0620 tprJ, - TP0621 nifU, - TP0615 rpiA, - TP0616 TP0611 TP0613 nifS, - TP0614 TP0612 TP0617 TP0618 TP0619 tprI, - TP0620 tprJ, - TP0621 nifU, - TP0615 rpiA, - TP0616 TP0611 TP0613 nifS, - TP0614 TP0612 Type: tandem, Name:  - 142 Type: tandem, Name:  - 143 TP0618 TP0619 tprI, - TP0620 tprJ, - TP0621 TP0617 nifU, - TP0615 rpiA, - TP0616 TP0611 TP0613 nifS, - TP0614 TP0612
* Calculated from Protein Sequence

Gene ID: TP0616

DNA Molecule Name:
1  

Genbank ID:
3322914

Gene Name:
rpiA  

Definition:
ribose 5-phosphate isomerase (phosphoriboisomerase)

Gene Start:
668669

Gene Stop:
669430

Gene Length:
762

Molecular Weight*:
27558

pI*:
6.73

Net Charge*:
-1.12

EC:
5.3.1.6  

Functional Class:
Energy metabolism; Pentose phosphate pathway  

Pathway: pathway table
Carbohydrate metabolism; Pentose phosphate cycle
Energy metabolism; Carbon fixation

Secondary Evidence:
Zhang R, Andersson CE, Savchenko A, Skarina T, Evdokimova E, Beasley S, Arrowsmith CH, Edwards AM, Joachimiak A, Mowbray SL.
Structure of Escherichia coli Ribose-5-Phosphate Isomerase. A Ubiquitous Enzyme of the Pentose Phosphate Pathway and the Calvin Cycle.
Structure (Camb). 2003 Jan;11(1):31-42.
PMID: 12517338

Lohrke SM, Dery PD, Li W, Reedy R, Kobayashi DY, Roberts DR.
Mutation of rpiA in Enterobacter cloacae decreases seed and root colonization and biocontrol of damping-off caused by Pythium ultimum on cucumber.
Mol Plant Microbe Interact. 2002 Aug;15(8):817-25.
PMID: 12182339

Sørensen KI, Hove-Jensen B.
Ribose catabolism of Escherichia coli: characterization of the rpiB gene encoding ribose phosphate isomerase B and of the rpiR gene, which is involved in regulation of rpiB expression.
J Bacteriol. 1996 Feb;178(4):1003-11.
PMID: 8576032

Comment:
This enzyme is part of the nonoxidative branch of the pentose phosphate
pathway.

Reaction:
D-RIBOSE 5-PHOSPHATE = D-RIBULOSE 5-PHOSPHATE.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to ribose 5-phosphate
isomerases. For example residues 18-233 are 40% similar to ribose-5-
phosphate isomerase of Methanococcus jannaschii,(U67600).

COGS Summary:  COGS Search
BeTs to 10 clades of COG0120
COG name: Ribose 5-phosphate isomerase
Functional Class:? G
The phylogenetic pattern of COG0120 is amtky--ce--h----olin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 28-231 are 415 similar to ribose 5-phosphate isomerase of
RPIA_MOUSE.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 68 to 247 (E-value = 2.2e-91) place TP0616 in the Rib_5-P_isom_A family which is described as Ribose 5-phosphate isomerase A (phosphoriboisomerase A) (PF06026)

PDB Hit:
none

Gene Protein Sequence:
MHERNTTTNTPLDVTAQKLLVAQRSVDTLVQEGVLHAHMSIGLGTGSTAM
PAVKRIADHLARGTLSDIAAVPTSFQTALICERYNIPLFSLSSKRIGGKL
DVTIDGADEIDTQNFVIKGGGAALLQEKIAAYNSAHFVIIVDETKVVETL
GTRAALPIEVVPEARMSVMRTLQDWGLSVHIREAVRKKGPVVTDHGNFIL
DARWQSLPTRTPQDMERALNALPGVIENGLFTERTVRVFVAHADGSVEER
SASF

Gene Nucleotide Sequence:  Sequence Viewer
ATGCACGAGAGGAACACGACGACGAACACCCCATTAGACGTTACCGCGCA
GAAATTGCTGGTTGCCCAGCGCAGCGTGGACACCCTCGTTCAAGAGGGGG
TGCTGCACGCGCACATGAGTATTGGCCTTGGGACGGGCTCTACGGCAATG
CCTGCGGTAAAACGCATCGCAGATCACCTTGCACGCGGCACTCTCTCTGA
CATAGCGGCAGTGCCCACTAGTTTTCAAACAGCGCTCATATGTGAGCGGT
ACAACATCCCCCTTTTTTCTCTCAGTTCAAAACGGATTGGGGGCAAACTG
GATGTGACTATCGACGGCGCGGATGAAATTGACACCCAAAATTTTGTCAT
CAAAGGCGGTGGAGCTGCGCTTTTGCAAGAAAAGATCGCTGCATACAACA
GCGCGCACTTTGTTATCATCGTAGACGAAACAAAGGTGGTAGAAACCTTA
GGTACGCGCGCAGCGCTCCCTATCGAAGTGGTGCCTGAGGCCCGCATGAG
CGTGATGCGCACGCTTCAGGATTGGGGGTTGTCCGTGCACATACGCGAAG
CGGTAAGAAAAAAAGGACCGGTAGTGACTGACCACGGAAATTTTATTTTA
GACGCGCGGTGGCAATCGCTCCCGACGCGCACCCCGCAAGACATGGAACG
CGCGCTCAATGCACTGCCGGGGGTCATTGAAAATGGCTTGTTCACCGAGC
GAACCGTACGCGTCTTTGTTGCGCACGCAGACGGTTCGGTAGAGGAGCGC
TCGGCCTCCTTC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy