Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap tRNA-Arg-3 IGR429 IGR434 IGR436 IGR431 IGR430 IGR435 IGR432 IGR433 rrf, - TP0604 TP0603 tsf, - TP0605 rpsB, - TP0606 TP0608 TP0611 TP0612 asnS, - TP0609 tprH, - TP0610 rrf, - TP0604 TP0603 tsf, - TP0605 rpsB, - TP0606 TP0608 TP0611 TP0612 asnS, - TP0609 tprH, - TP0610 Type: tandem, Name:  - 141 Type: tandem, Name:  - 258 TP0603 tsf, - TP0605 rpsB, - TP0606 TP0608 TP0607 TP0607 rrf, - TP0604 TP0611 TP0612 asnS, - TP0609 tprH, - TP0610
* Calculated from Protein Sequence

Gene ID: TP0609

DNA Molecule Name:
1  

Genbank ID:
3322907

Gene Name:
asnS  

Definition:
asparaginyl-tRNA synthetase

Gene Start:
659665

Gene Stop:
661233

Gene Length:
1569

Molecular Weight*:
57787

pI*:
7.07

Net Charge*:
0.57

EC:
6.1.1.22  

Functional Class:
Translation; Amino acyl tRNA synthetases  

Pathway: pathway table
Metabolism of macromolecules; Aminoacyl-tRNA biosynthesis

Secondary Evidence:
Kim SI, Nalaskowska M, Germond JE, Pridmore D, Söll D.
Asn-tRNA in Lactobacillus bulgaricus is formed by asparaginylation of tRNA and not by transamidation of Asp-tRNA.
Nucleic Acids Res. 1996 Jul;24(14):2648-51.
PMID: 8758990

Seignovert L, Härtlein M, Leberman R.
Asparaginyl-tRNA synthetase from Thermus thermophilus HB8. Sequence of the gene and crystallization of the enzyme expressed in Escherichia coli.
Eur J Biochem. 1996 Jul;239(2):501-8.
PMID: 8706760

Kim SI, Germond JE, Pridmore D, Söll D.
Lactobacillus bulgaricus asparagine synthetase and asparaginyl-tRNA synthetase: coregulation by transcription antitermination?.
J Bacteriol. 1996 Apr;178(8):2459-61.
PMID: 8636057

Heng HH, Shi XM, Scherer SW, Andrulis IL, Tsui LC.
Refined localization of the asparagine synthetase gene (ASNS) to chromosome 7, region q21.3, and characterization of the somatic cell hybrid line 4AF/106/KO15.
Cytogenet Cell Genet. 1994;66(2):135-8.
PMID: 7904551

Comment:
Reaction:
ATP + L-ASPARAGINE + TRNA(ASN) = AMP + PYROPHOSPHATE + L-ASPARAGINYL-TRNA(ASN).

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to asparaginyl-tRNA
synthetase proteins. For example residues 23-523 are 48% similar to
SYN_ECOLI, asparaginyl-tRNA synthetase of E. coli,(X68192).

COGS Summary:  COGS Search
BeTs to 11 clades of COG0017
COG name: Aspartyl/asparaginyl-tRNA synthetases
Functional Class:? J
The phylogenetic pattern of COG0017 is amtKY--ceb-h--gpol---
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 164-332 are 56% similar to asparaginyl-tRNA synthetase of
SYN_SYNY3. Residues 368-442 and 443-514 also support this match.

Paralogs:  Local Blast Search
This protein is paralogously related to TP0985 aspartyl-tRNA synthetase.
Residues 23-309 are 24% similar and residues 438-521 are 31% similar
to TP0985.

Pfam Summary:  Pfam Search
Residues 21 to 124 (E-value = 1.2e-14) place TP0609 in the tRNA_anti family which is described as OB-fold nucleic acid binding domain (PF01336)
Residues 140 to 519 (E-value = 8.4e-104) place TP0609 in the tRNA-synt_2 family which is described as tRNA synthetases class II (D, K and N) (PF00152)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
109  
197
non-globular  
286  
377

PDB Hit:
none

Gene Protein Sequence:
MRAMHPLLKEILTHPPSGQHECVHGWVRSKRETKRAVFISLSDGSCPDTL
QVTVPLPECSASLSSGAQAEQIPNVRDAVLQGETLAQTLKRVTTGACIRA
EGALVPSPGAGQALELRACNLTVLGEAPAETYPLQKKSHSFEFLRAHAHL
RARTSTFAACARVRSALAGAVHRFFSERHFQYVHTPIITASDCEGAGELF
RVTTFDPVRIAREAHAAGAAGNPYALTYADDFFGKAARLTVSGQLQGEAY
ALALTRIYTFGPTFRAENSNTSRHLSEFWMVEPEIAFARITDCMDVAEEF
LAYLLRAALKDCAQDIAFLDERAAQHARSARGDTPLAARSTARTPPVRTP
GQLTRMLEDVARAPATRLTYTEAIKLLENSGRSFEFPVRWGCDLQSEHEC
FLTEEVFHGPVIVYDYPKEIKAFYMKLNADGTTVRSMDLLVPGLGEIMGG
SEREEQFEVLCARIRASGFDPHDYRWYTDLRRFGTAPHAGFGLGFERLLQ
YVTGLGNIRDVIPFPRTPRTADF

Gene Nucleotide Sequence:  Sequence Viewer
GTGCGTGCTATGCACCCTTTGCTCAAGGAGATTCTGACTCATCCCCCCTC
AGGCCAGCACGAATGCGTTCACGGTTGGGTGCGCTCCAAACGGGAGACAA
AACGCGCTGTCTTTATCAGTCTGAGCGACGGTTCTTGCCCTGATACCCTT
CAGGTTACCGTTCCCCTGCCCGAGTGTTCCGCCTCCCTTTCCTCTGGGGC
GCAAGCTGAGCAAATCCCTAATGTCCGCGACGCTGTCCTCCAGGGGGAAA
CGCTCGCTCAAACGCTCAAACGCGTTACTACCGGCGCCTGCATTCGCGCC
GAGGGTGCACTCGTCCCCTCCCCAGGCGCCGGGCAAGCGCTTGAGTTGCG
CGCTTGCAACCTGACTGTTCTTGGCGAGGCGCCTGCTGAAACCTATCCTT
TGCAGAAGAAATCGCATAGTTTTGAGTTTTTGCGTGCGCACGCCCATCTG
CGCGCGCGCACTAGTACCTTTGCCGCGTGTGCACGGGTGCGCAGTGCACT
TGCAGGCGCTGTCCACCGCTTTTTCTCCGAGCGACACTTTCAGTACGTGC
ACACACCGATCATTACCGCTTCGGACTGCGAGGGTGCAGGCGAGCTCTTT
CGCGTCACTACTTTTGATCCCGTGCGTATTGCGCGCGAAGCACACGCAGC
GGGCGCGGCAGGCAACCCCTACGCACTCACGTACGCGGACGACTTTTTTG
GTAAGGCAGCGCGCCTAACCGTTTCGGGCCAACTGCAGGGGGAAGCATAT
GCGCTTGCCCTCACGCGCATCTACACCTTCGGCCCTACTTTTCGCGCAGA
GAACTCAAATACTAGCCGCCATCTTTCTGAGTTCTGGATGGTGGAGCCGG
AAATCGCCTTTGCACGCATCACTGACTGCATGGACGTGGCAGAGGAGTTT
TTGGCGTACCTGCTACGCGCAGCACTCAAGGACTGCGCGCAGGATATAGC
CTTCCTTGACGAGCGCGCAGCGCAGCATGCGCGAAGCGCGCGGGGCGACA
CACCCCTTGCCGCGCGCAGCACAGCGCGCACACCGCCAGTGCGGACGCCA
GGGCAGCTGACGCGCATGCTCGAAGACGTCGCCCGCGCGCCTGCCACGCG
CCTGACATACACAGAGGCAATTAAACTACTGGAGAACAGTGGGCGCTCCT
TTGAGTTCCCCGTACGCTGGGGATGCGATTTACAAAGCGAGCACGAGTGT
TTTTTAACAGAAGAGGTGTTCCACGGCCCGGTGATTGTCTATGACTACCC
AAAGGAAATCAAGGCCTTCTACATGAAGCTCAATGCCGACGGCACAACGG
TGCGTTCCATGGACCTGCTAGTTCCGGGATTAGGGGAGATTATGGGAGGC
TCGGAGCGCGAGGAACAGTTTGAAGTACTCTGTGCTCGCATCCGTGCCAG
CGGTTTTGACCCTCACGACTATCGCTGGTACACCGATCTCCGTCGCTTTG
GTACCGCGCCCCATGCAGGTTTTGGACTCGGCTTCGAGCGCTTGCTGCAG
TACGTCACCGGGCTTGGGAATATTCGGGATGTTATTCCGTTTCCTCGTAC
GCCGCGCACTGCGGACTTT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy