Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap tRNA-Arg-3 IGR429 IGR434 IGR431 IGR430 IGR432 IGR433 rrf, - TP0604 TP0603 tsf, - TP0605 rpsB, - TP0606 TP0608 TP0601 asnS, - TP0609 tprH, - TP0610 rrf, - TP0604 TP0603 tsf, - TP0605 rpsB, - TP0606 TP0608 TP0601 asnS, - TP0609 tprH, - TP0610 Type: tandem, Name:  - 258 Type: tandem, Name:  - 138 Type: tandem, Name:  - 139 Type: tandem, Name:  - 140 rrf, - TP0604 TP0603 tsf, - TP0605 rpsB, - TP0606 TP0608 TP0601 TP0607 cdsA, - TP0602 cdsA, - TP0602 TP0607 asnS, - TP0609 tprH, - TP0610
* Calculated from Protein Sequence

Gene ID: TP0607

DNA Molecule Name:
1  

Genbank ID:
3322904

Gene Name:


Definition:
hypothetical protein(basic)

Gene Start:
658207

Gene Stop:
658064

Gene Length:
144

Molecular Weight*:
5434

pI*:
10.81

Net Charge*:
3.93

EC:
 

Functional Class:
Hypothetical  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Gapped BLAST revealed no significant hits in the database.

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
none

Gene Protein Sequence:
MTVCEGTRFSVLSRISPARVRVVKERRMRASALSVEEWYGSGDYQKSA

Gene Nucleotide Sequence:  Sequence Viewer
GTGACCGTGTGTGAGGGGACGCGTTTTTCTGTCCTCTCGAGAATATCCCC
GGCGCGTGTGCGTGTGGTGAAAGAGAGAAGGATGAGAGCCTCGGCGCTCT
CTGTGGAGGAATGGTATGGCAGTGGTGACTATCAAAAATCTGCT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy