Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap tRNA-Arg-3 IGR429 IGR428 IGR427 IGR431 IGR430 IGR432 IGR433 rrf, - TP0604 TP0599 TP0603 tsf, - TP0605 rpsB, - TP0606 TP0608 TP0601 TP0600 TP0598 asnS, - TP0609 rrf, - TP0604 TP0599 TP0603 tsf, - TP0605 rpsB, - TP0606 TP0608 TP0601 TP0600 TP0598 asnS, - TP0609 Type: tandem, Name:  - 258 Type: tandem, Name:  - 138 Type: tandem, Name:  - 139 Type: tandem, Name:  - 140 rrf, - TP0604 TP0599 TP0603 tsf, - TP0605 rpsB, - TP0606 TP0608 TP0601 TP0600 TP0598 TP0607 cdsA, - TP0602 cdsA, - TP0602 TP0607 asnS, - TP0609
* Calculated from Protein Sequence

Gene ID: TP0603

DNA Molecule Name:
1  

Genbank ID:
3322897

Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
655593

Gene Stop:
654910

Gene Length:
684

Molecular Weight*:
26256

pI*:
8.64

Net Charge*:
5.45

EC:
 

Functional Class:
Conserved hypothetical  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to hypothetical proteins.
For example residues 1-228 are 41% similar to YC21_HELPY, a conserved
hypothetical protein of Helicobacter pylori,(AE000627).

COGS Summary:  COGS Search
BeTs to 16 clades of COG0020
COG name: Undecaprenyl pyrophosphate synthase
Functional Class:  I
The phylogenetic pattern of COG0020 is AmtkYqvcebRhuj--olinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 3-16, 44-69, 87-141, and 171-194 represent significant (100%)
hits to blocks BL01066A,B,C,D, Uncharacterized protein family UPF0015
proteins.

ProDom Summary:  Protein Domain Search
Residues 2-107 are 38% similar to YC21_HELPY, a hypothetical protein
that belongs to the UPF0015 family.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 7 to 226 (E-value = 7.3e-81) place TP0603 in the UPP_synthetase family which is described as Putative undecaprenyl diphosphate synthase (PF01255)

PDB Hit:
none

Gene Protein Sequence:
MQHVAIIMDGNGRWAERRGLRRSAGHRRGLQTAREIVAALCAIRVPFVTL
YVFSTENWKRSAHEVHFLMNLIRWYLKKEMSFYVEHAIRVVHLGCAQTLP
PDVRSQIEYVVERTRSHRGTTVALAINYGGKDEILRAVKKVLCSTSCPDG
ELLTEEAFGACLDAPQLPSVDFLIRTGGQQRMSNFLLWQSAYAEFYFTDI
LWPDFRVEDMLRALDEYRLRTRTFGGLE

Gene Nucleotide Sequence:  Sequence Viewer
GTGCAGCACGTGGCCATCATCATGGATGGAAACGGGAGATGGGCGGAAAG
GAGAGGGTTGCGGCGCAGTGCAGGGCACCGGCGGGGGCTGCAGACAGCGC
GAGAGATTGTCGCGGCGCTGTGCGCGATTCGGGTGCCTTTTGTTACTCTG
TATGTGTTTTCTACTGAAAACTGGAAGCGCTCTGCGCATGAAGTGCATTT
CTTGATGAATTTAATCAGGTGGTATTTGAAAAAGGAGATGTCATTCTATG
TGGAGCATGCCATTCGCGTAGTGCACCTGGGTTGTGCGCAGACACTTCCG
CCTGATGTGCGCAGCCAGATAGAGTATGTTGTGGAACGCACTCGGTCTCA
TCGGGGAACTACTGTTGCGCTTGCTATAAATTATGGGGGAAAAGATGAAA
TTTTACGTGCGGTAAAAAAGGTTTTGTGCAGCACTTCGTGCCCGGATGGT
GAGCTTCTCACCGAAGAAGCTTTCGGCGCGTGCCTTGATGCGCCGCAGTT
GCCGAGTGTCGACTTTCTCATCAGAACAGGGGGTCAGCAACGCATGAGTA
ATTTTTTGCTTTGGCAAAGCGCGTACGCGGAGTTCTATTTTACCGATATC
CTGTGGCCTGACTTTCGGGTAGAAGACATGCTGCGCGCCCTGGATGAGTA
TCGCCTGCGCACGCGTACCTTTGGGGGTTTGGAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy