Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap tRNA-Arg-3 IGR429 IGR428 IGR427 IGR431 IGR430 IGR432 IGR433 rrf, - TP0604 TP0599 TP0603 tsf, - TP0605 rpsB, - TP0606 TP0608 TP0601 TP0600 TP0598 rrf, - TP0604 TP0599 TP0603 tsf, - TP0605 rpsB, - TP0606 TP0608 TP0601 TP0600 TP0598 Type: tandem, Name:  - 138 Type: tandem, Name:  - 139 Type: tandem, Name:  - 140 rrf, - TP0604 TP0599 TP0603 tsf, - TP0605 rpsB, - TP0606 TP0608 TP0601 TP0600 TP0598 TP0607 cdsA, - TP0602 cdsA, - TP0602 TP0607
* Calculated from Protein Sequence

Gene ID: TP0602

DNA Molecule Name:
1  

Genbank ID:
3322896

Gene Name:
cdsA  

Definition:
CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) (CDP-diglyceride synthetase) (CDP-diglyceride pyrophorylase)

Gene Start:
654910

Gene Stop:
654050

Gene Length:
861

Molecular Weight*:
30854

pI*:
7.90

Net Charge*:
2.86

EC:
2.7.7.41  

Functional Class:
Fatty acid and phospholipid metabolism  

Pathway: pathway table
Metabolism of complex lipids; Glycerolipid metabolism

Comment:
This enzyme is an important part of the phospholipid pathway.

Reaction:
CTP + PHOSPHATIDATE = PYROPHOSPHATE + CDP-DIACYLGLYCEROL.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to CDP-diglyceride
synthetases. For example residues 38-275 are 27% similar to CDSA_PSEAE,
phosphatidate cytidylyltransferase of Pseudomonas aeruginosa,(D50811).

COGS Summary:  COGS Search
BeTs to 13 clades of COG0575
COG name: CDP-diglyceride synthetase
Functional Class:  I
The phylogenetic pattern of COG0575 is amtkyqvcEbrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 152-266 are 37% similar to CDP-diacylglycerol synthase of
CDSA_ECOLI.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 5 to 282 (E-value = 6.7e-79) place TP0602 in the CTP_transf_1 family which is described as Cytidylyltransferase family (PF01148)

Structural Feature(s):
Feature Type  Start  Stop
gram positive signal  
1  
24
transmembrane  
30  
48
transmembrane  
57  
80
transmembrane  
87  
113
transmembrane  
124  
146
transmembrane  
150  
172
transmembrane  
192  
212
transmembrane  
216  
236

PDB Hit:
none

Gene Protein Sequence:
MSAEIKRLLIFFFGVPTILMLVYAAPHAHFLAFHLVIFGSVMGAVWEMHA
MVSRRMCTYPLVLLIPFSLVLPLLGYAALWQPARGAESVLFIGALGTLLM
SVFFTELVYSFSASFENALERMASALLLVLYPGIFSLFFSLITRWRHAEI
ALVIFFLMVFTCDSCAWFCGTLWGVNNRGIIPASPKKSIAGFIGGFAGSV
GAGCFGSLVFGSRVTLSLGMLMGVGALVGLTAIVGDLVESVMKRSAQVKD
SGFFTPGRGGIMDNLDSLAPSLGTFYIACECFGIAAV

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGCGCGGAAATAAAGAGGCTGTTAATCTTTTTTTTCGGCGTTCCAAC
TATTCTTATGTTGGTATATGCGGCACCGCATGCACACTTCCTAGCGTTCC
ATTTGGTTATCTTCGGATCAGTTATGGGTGCGGTATGGGAAATGCATGCG
ATGGTGTCGCGCAGGATGTGCACGTACCCACTGGTTTTGTTGATCCCTTT
CAGTCTTGTGCTTCCGCTTTTAGGATATGCAGCGCTGTGGCAGCCTGCAC
GGGGCGCTGAATCTGTCCTTTTTATTGGAGCACTGGGCACGCTGCTCATG
AGTGTTTTTTTCACCGAATTGGTGTATTCGTTTTCTGCTTCTTTTGAAAA
CGCCCTTGAGCGTATGGCCTCGGCACTGTTGCTTGTTTTGTATCCAGGTA
TCTTTAGCCTTTTTTTTTCGCTCATTACGCGGTGGCGTCATGCAGAGATC
GCATTGGTAATTTTTTTTCTCATGGTTTTTACGTGCGACTCTTGTGCATG
GTTCTGTGGGACGCTCTGGGGAGTCAACAACAGAGGGATAATTCCTGCAA
GTCCTAAAAAGAGTATTGCAGGTTTTATTGGAGGTTTTGCCGGTTCGGTA
GGTGCAGGGTGTTTTGGCTCACTTGTATTTGGTTCGCGTGTGACGCTCTC
TTTGGGGATGCTCATGGGTGTTGGAGCCTTGGTAGGACTGACTGCCATTG
TAGGCGATCTAGTCGAGTCGGTGATGAAACGTTCGGCTCAGGTAAAGGAT
TCAGGATTTTTTACCCCCGGGCGGGGCGGAATTATGGATAACCTGGATTC
GCTTGCGCCGTCACTGGGGACTTTTTACATTGCATGTGAGTGTTTTGGGA
TCGCTGCAGTA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy