Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR428 IGR425 IGR424 IGR427 IGR423 IGR426 TP0594 adk, - TP0595 TP0599 pcnB, - TP0596 TP0601 TP0600 TP0598 TP0593 TP0594 adk, - TP0595 TP0599 pcnB, - TP0596 TP0601 TP0600 TP0598 TP0593 Type: tandem, Name:  - 136 Type: tandem, Name:  - 137 TP0594 adk, - TP0595 TP0599 pcnB, - TP0596 TP0601 TP0600 TP0598 TP0597 TP0597 TP0593 TP0592 TP0592
* Calculated from Protein Sequence

Gene ID: TP0596

DNA Molecule Name:
1  

Genbank ID:
3322888

Gene Name:
pcnB  

Definition:
polynucleotide adenylyltransferase (plasmid copy number control protein)

Gene Start:
648704

Gene Stop:
647595

Gene Length:
1110

Molecular Weight*:
41303

pI*:
10.71

Net Charge*:
23.35

EC:
2.7.7.19  

Functional Class:
Transcription; DNA-dependent RNA polymerase  

Pathway: pathway table
Miscellaneous Enzymes

Secondary Evidence:
Jasiecki J, Wegrzyn G.
Growth-rate dependent RNA polyadenylation in Escherichia coli.
EMBO Rep. 2003 Feb;4(2):172-7.
PMID: 12612607

Sarkar N, Cao GJ, Jain C.
Identification of multicopy suppressors of the pcnB plasmid copy number defect in Escherichia coli.
Mol Genet Genomics. 2002 Sep;268(1):62-9.
PMID: 12242500

Binns N, Masters M.
Expression of the Escherichia coli pcnB gene is translationally limited using an inefficient start codon: a second chromosomal example of translation initiated at AUU.
Mol Microbiol. 2002 Jun;44(5):1287-98.
PMID: 12068810

Feng Y, Cohen SN.
Unpaired terminal nucleotides and 5' monophosphorylation govern 3' polyadenylation by Escherichia coli poly(A) polymerase I.
Proc Natl Acad Sci U S A. 2000 Jun;97(12):6415-20.
PMID: 10823925

Mohanty BK, Kushner SR.
Residual polyadenylation in poly(A) polymerase I (pcnB ) mutants of Escherichia coli does not result from the activity encoded by the f310 gene.
Mol Microbiol. 1999 Dec;34(5):1109-19.
PMID: 10594834

Comment:
In E. coli, PcnB is a polymerase that creates the 3' poly (A) tail
found in some mRNAs. It seems to be involved in plasmid copy number
control.

Reaction:
N ATP + (NUCLEOTIDE)(M) = N PYROPHOSPHATE + (NUCLEOTIDE)(M+N).

See TP0270, pcnA.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed the N-terminal and middle region of the protein
had several significant hits to polynucleotide adenylyltransferase (pcnB).
For example residues 19-254 are 38% similar to PCNB_ECOLI, polynucleotide
adenylyltransferase of Escherichia coli,(AE000123).

COGS Summary:  COGS Search
BeTs to 12 clades of COG0617
COG name: tRNA nucleotidyltransferase/poly(A) polymerase
Functional Class:? J
The phylogenetic pattern of COG0617 is ----yQvCEbrHuj--oLINx
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 36-112 are 53% similar to polynucleotide adenylyltransferase
of PCNB_ECOLI. Residues 125-186 also support this match.

Paralogs:  Local Blast Search
This protein is paralogously related to TP0270, polynucleotide
adenylyltransferase (pcnA). Residues 39-251 are 32% similar to
TP0270.

Pfam Summary:  Pfam Search
Residues 108 to 257 (E-value = 1.2e-60) place TP0596 in the PolyA_pol family which is described as Poly A polymerase family (PF01743)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
241

PDB Hit:
none

Gene Protein Sequence:
MLVRYSYDAKGRRLGRALVYTESEHGIPRQSVDAGAIRVVEALVGAGYET
YIVGGAVRDLVAGRTPKDFDIVTGAVPSRIRRLFRNSRIIGRRFRIVHVS
CGSQLYEVSTFRSRVGEGSVCVPGTLEEDAWRRDFSVNALYYDPLRNVVI
DCVGGMVDLKRRRVRPLIPLRSIFVEDPVRMLRALKCSVMCESSIPFSVR
RSIRRSVSLLGGCSPSRLTDEFVKILFSGRSAALVRALCGYQLLLYLQPS
VHYFMRDVPCFESAFFASLRVLDQAFVSGRVKRVGQALTYVLRDFVGLVF
GHADAPDEVYIRVYRACRSFVLPMNPPRVELEYAVRSCLGGRGFAARAAC
TPSGRLCARENGVRCVFSSP

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTGGTTCGCTACAGTTACGATGCAAAGGGAAGGCGGTTGGGGCGTGC
GCTGGTGTACACTGAGTCGGAGCACGGTATACCTCGGCAGAGCGTTGACG
CTGGGGCGATAAGGGTTGTAGAAGCGCTGGTGGGTGCGGGGTATGAAACC
TATATCGTCGGTGGGGCGGTAAGGGACCTGGTTGCGGGAAGGACACCAAA
AGATTTTGACATTGTTACAGGCGCAGTTCCCTCTAGGATTCGTAGGTTGT
TCAGGAACTCGCGCATTATCGGCAGGCGCTTCCGCATTGTTCATGTGTCG
TGTGGCTCGCAGCTGTACGAGGTTTCCACCTTTCGCTCTCGTGTGGGGGA
AGGTTCGGTGTGTGTTCCTGGCACGTTGGAGGAAGATGCATGGCGGAGGG
ACTTTAGTGTCAATGCCTTGTACTATGATCCTCTGAGAAATGTGGTGATC
GATTGTGTCGGTGGAATGGTTGATCTGAAGAGGCGTCGCGTGCGGCCGCT
CATACCTCTGCGGTCCATCTTTGTAGAGGACCCAGTGCGCATGCTCCGGG
CATTGAAGTGCTCGGTGATGTGCGAGTCTTCCATCCCTTTTTCTGTCCGC
CGCAGTATTCGCCGCAGTGTTTCCCTTCTTGGGGGGTGCTCTCCCTCCCG
GTTGACCGACGAATTTGTAAAAATCCTCTTTTCCGGTCGGAGCGCCGCGC
TTGTGCGCGCCCTATGTGGGTACCAGCTCCTTCTGTACTTGCAGCCGTCT
GTGCACTACTTTATGCGGGATGTGCCGTGCTTTGAGAGCGCTTTTTTTGC
AAGCTTGAGGGTGCTAGATCAGGCTTTTGTGTCTGGGAGGGTGAAGCGTG
TGGGGCAAGCGCTTACGTACGTGCTGCGCGATTTTGTCGGCCTGGTGTTT
GGTCATGCAGACGCACCGGATGAGGTGTACATAAGGGTGTATCGAGCATG
TCGCAGTTTTGTGTTGCCAATGAATCCTCCCCGTGTAGAATTGGAGTACG
CGGTGCGCTCTTGTTTGGGCGGTCGGGGTTTCGCGGCGCGCGCGGCGTGT
ACGCCTTCGGGTCGGTTGTGTGCGCGAGAGAACGGGGTGAGGTGTGTTTT
TTCTTCCCCG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy