Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap tRNA-Met-2 tRNA-Asp-1 tRNA-Pro-1 IGR428 IGR425 IGR424 IGR427 IGR423 IGR426 IGR422 TP0594 adk, - TP0595 TP0599 pcnB, - TP0596 TP0600 TP0598 TP0593 TP0594 adk, - TP0595 TP0599 pcnB, - TP0596 TP0600 TP0598 TP0593 Type: tandem, Name:  - 135 Type: tandem, Name:  - 136 Type: tandem, Name:  - 137 TP0594 adk, - TP0595 TP0599 pcnB, - TP0596 TP0600 TP0598 TP0597 TP0597 TP0593 TP0592 TP0592
* Calculated from Protein Sequence

Gene ID: TP0595

DNA Molecule Name:
1  

Genbank ID:
3322887

Gene Name:
adk  

Definition:
adenylate kinase

Gene Start:
647568

Gene Stop:
646936

Gene Length:
633

Molecular Weight*:
22918

pI*:
8.22

Net Charge*:
3.68

EC:
2.7.4.3  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Purine ribonucleotide biosynthesis  

Pathway: pathway table
Nucleotide metabolism; Purine Metabolism
Nucleotide metabolism; Pyrimidine Metabolism

Secondary Evidence:
Munier-Lehmann H, Chenal-Francisque V, Ionescu M, Christova P, Foulon J, Carniel E, Barzu O.
Relationship between bacterial virulence and nucleotide metabolism: a mutation in the adenylate kinase gene renders Yersinia pestis avirulent.
Biochem J. 2003 Apr;Pt.
PMID: 12693989

Ferber DM, Haney PJ, Berk H, Lynn D, Konisky J.
The adenylate kinase genes of M. voltae, M. thermolithotrophicus, M. jannaschii, and M. igneus define a new family of adenylate kinases.
Gene. 1997 Feb;185(2):239-44.
PMID: 9055821

Feil E, Carpenter G, Spratt BG.
Electrophoretic variation in adenylate kinase of Neisseria meningitidis is due to inter- and intraspecies recombination.
Proc Natl Acad Sci U S A. 1995 Nov;92(23):10535-9.
PMID: 7479835

Comment:
This enzyme is essential for maintence and cell growth.

Reaction:
ATP + AMP = ADP + ADP.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to adenylate kinases.
For example residues 1-205 are 42% similar to KAD_BACSU, adenylate
kinase of Bacillus subtilis.

COGS Summary:  COGS Search
BeTs to 15 clades of COG0563
COG name: Adenylate kinase/yeast uridylate kinase
Functional Class:? F
The phylogenetic pattern of COG0563 is a--kYqvCebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 4-36, 80-97, and 152-185 represent significant (99%) hits to
BL00113A,B,C, Adenylate kinase proteins. Residues 2-17 represent
a significant (99%) hit to block PR00819B, CBXX/CFQX SUPERFAMILY
SIGNATURE.

ProDom Summary:  Protein Domain Search
Residues 1-110 are 41% similar to adenylate kinase of KAD_BACSU.
Residues 152-181 also support this match.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 5 to 186 (E-value = 6.6e-56) place TP0595 in the ADK family which is described as Adenylate kinase (PF00406)
Residues 122 to 157 (E-value = 2e-18) place TP0595 in the ADK_lid family which is described as Adenylate kinase, active site lid (PF05191)

PDB Hit:
gi|2392647|pdb|1ZIN| Adenylate Kinase With Bound Ap5a Phosphotransferase, Zinc Finger Mol_id: 1; Molecule: Adenylate Kinase; Chain: Null; Synonym: Adk; Ec: 2.7.4.3; Other_details: Zinc Finger

Gene Protein Sequence:
MRFVFLGPPGAGKGTLAGEISGRCGVVHISTGGILRAAIQKQTALGKKVQ
KVVEVGGLVDDQTVTELVRERVSHEDVVSGFILDGFPRTVTQARCLEDIV
PIDYAVSIVVPDDVLVARLTGRRVCSACGSSYHVLFAQPKREGVCDRCRG
VLVVREDDKMSAILQRLTAYRAQAEPIVHFYSERGKLVSLNGAPPISDVV
LEFQERFAQSR

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGGTTTGTTTTTCTTGGTCCTCCTGGTGCCGGTAAGGGTACGCTTGC
AGGTGAAATTTCTGGGCGTTGTGGCGTTGTGCACATCTCCACAGGGGGTA
TTCTTCGGGCAGCAATTCAGAAACAGACGGCATTAGGTAAAAAAGTTCAA
AAAGTAGTTGAAGTGGGCGGCTTGGTAGATGACCAGACCGTTACGGAGCT
AGTGCGGGAGCGTGTCAGTCACGAAGATGTGGTTAGCGGTTTTATTCTAG
ATGGGTTTCCTCGCACTGTCACGCAGGCTAGGTGCTTAGAGGACATTGTG
CCGATAGACTACGCGGTGAGTATTGTAGTACCGGACGATGTCCTTGTTGC
GCGTCTTACTGGCCGCAGGGTGTGTTCGGCCTGTGGGAGCAGTTATCATG
TGCTCTTTGCGCAGCCTAAGAGAGAGGGTGTGTGCGATCGGTGTAGAGGA
GTACTGGTCGTGCGGGAGGATGACAAGATGTCGGCAATTCTTCAGAGGCT
TACCGCCTATCGAGCGCAGGCGGAGCCCATTGTCCACTTTTACAGTGAGC
GGGGGAAATTAGTTTCTCTTAATGGTGCTCCGCCGATATCGGATGTAGTG
TTGGAGTTTCAAGAGCGTTTTGCACAATCACGG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy