Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap tRNA-Met-2 tRNA-Arg-2 tRNA-Asp-1 tRNA-Pro-1 IGR420 IGR421 IGR419 IGR423 IGR422 TP0587 ptsH, - TP0589 TP0594 TP0588 ptsK, - TP0591 opp,dpp, - TP0585 TP0593 leuS, - TP0586 TP0587 ptsH, - TP0589 TP0594 TP0588 ptsK, - TP0591 opp,dpp, - TP0585 TP0593 leuS, - TP0586 Type: tandem, Name:  - 133 Type: tandem, Name:  - 134 Type: tandem, Name:  - 135 TP0594 TP0588 ptsK, - TP0591 TP0590 ptsH, - TP0589 TP0587 TP0590 opp,dpp, - TP0585 TP0593 leuS, - TP0586 TP0592 TP0592
* Calculated from Protein Sequence

Gene ID: TP0591

DNA Molecule Name:
1  

Genbank ID:
3322886

Gene Name:
ptsK  

Definition:
HPr kinase

Gene Start:
641975

Gene Stop:
641019

Gene Length:
957

Molecular Weight*:
35830

pI*:
6.73

Net Charge*:
-1.57

EC:
2.7.1.-  

Functional Class:
Transport and binding proteins; Carbohydrates, organic alcohols, and acids  

Pathway: pathway table
Metabolism of complex carbohydrates; Starch and sucrose metabolism

Secondary Evidence:
Ramström H, Sanglier S, Leize-Wagner E, Philippe C, Van Dorsselaer A, Haiech J.
Properties and regulation of the bifunctional enzyme HPr kinase/phosphatase in Bacillus subtilis.
J Biol Chem. 2003 Jan;278(2):1174-85.
PMID: 12411438

Hu KY, Saier MH.
Phylogeny of phosphoryl transfer proteins of the phosphoenolpyruvate-dependent sugar-transporting phosphotransferase system.
Res Microbiol. 2002 Sep;153(7):405-15.
PMID: 12405346

Reizer J, Hoischen C, Titgemeyer F, Rivolta C, Rabus R, Stülke J, Karamata D, Saier MH, Hillen W.
A novel protein kinase that controls carbon catabolite repression in bacteria.
Mol Microbiol. 1998 Mar;27(6):1157-69.
PMID: 9570401

Comment:
This kinase regulates carbohydrate uptake and metabolism by
phosphorylating the phosphoryl carrier protein of the phosphoenolpyruvate-
dependent sugar phosphotransferase system (pts).

Reaction:
ATP + A PROTEIN = ADP + A PHOSPHOPROTEIN.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed significant hits to three HPr kinases and two
hypothetical proteins. For example residues 8-307 are 42% similar
to HPr(Ser) kinase of Bacillus subtilis,(AF017113).

COGS Summary:  COGS Search
BeTs to 3 clades of COG1493
COG name: Serine kinase of the HPr protein, regulates carbohydrate metabolism
Functional Class:? T
The phylogenetic pattern of COG1493 is ---------b----gp-l---
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 258-277 and 148-173 represent signifcant (99%) hits to blocks
PR00193A,B, MYOSIN HEAVY CHAIN SIGNATURE.

ProDom Summary:  Protein Domain Search
Residues 12-304 are 35% similar to Y085_MYCPN, a hypothetical protein.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 2 to 309 (E-value = 3.5e-228) place TP0591 in the Hpr_kinase family which is described as HPr Serine kinase (PF02603)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
126  
149

PDB Hit:
none

Gene Protein Sequence:
VLKLDLKERDSLDLRCIAGHHGLANPITISDLNRPGLVLSGFFDFVAYRR
IQLFGRGEHAYLLALLEQGRYGAIEKMFTFDLPCCIFSHGITPPEKFLHL
AEPSSCPILVTRLTSSELSLRLMRVLSNIFAPTIALHGVLVEVYGVGILI
SGDSGVGKSETALELIERGHRLVADDLVEISCVNGNSLIGRGVHKSIGHH
MEIRGLGIINITQLYGVGSIRERKEIQMVVQLEEWNSSKAYDRLGTQELN
TTILDVSVPLIEIPVRPGRNIPIILETAAMNERLKRMGYFSAKEFNQSVL
KLMEQNAAHAPYYRPDDTY

Gene Nucleotide Sequence:  Sequence Viewer
GTGCTCAAGCTCGATCTGAAAGAGCGCGATTCGCTTGATCTGCGTTGTAT
CGCAGGTCACCATGGACTGGCAAATCCCATCACTATCTCGGATCTGAACC
GACCAGGTCTTGTCCTGTCAGGCTTTTTTGACTTCGTTGCCTACCGGCGG
ATCCAGCTTTTTGGCCGCGGAGAACATGCGTATCTGCTCGCCCTTTTAGA
GCAGGGACGATACGGTGCTATCGAAAAGATGTTCACCTTTGACTTGCCTT
GTTGTATCTTTTCCCATGGAATTACCCCGCCGGAGAAGTTTTTGCATCTT
GCTGAGCCTTCTTCTTGCCCTATCTTGGTCACTCGTCTTACGTCGAGCGA
GCTTTCTTTACGTCTCATGCGTGTTCTCTCCAATATCTTCGCACCGACGA
TAGCGCTTCATGGAGTATTGGTGGAGGTGTATGGCGTCGGGATTCTTATT
TCAGGAGATTCAGGAGTAGGAAAAAGTGAGACTGCTCTGGAGTTAATTGA
GCGCGGTCATCGACTTGTTGCAGATGACTTAGTAGAAATTTCTTGCGTCA
ATGGAAATAGCCTCATTGGGCGGGGGGTGCACAAAAGTATCGGTCACCAT
ATGGAAATTCGCGGTTTAGGAATCATCAATATTACACAGCTGTACGGGGT
CGGTTCTATCAGGGAGCGGAAAGAAATACAAATGGTGGTTCAACTTGAAG
AGTGGAATTCTTCAAAGGCCTATGATCGTCTCGGTACGCAGGAGCTGAAC
ACTACTATTTTGGACGTCAGTGTTCCCCTTATAGAAATACCGGTAAGGCC
CGGAAGGAACATCCCCATCATCCTGGAGACAGCTGCTATGAACGAGCGTT
TAAAGCGTATGGGCTATTTTTCTGCAAAGGAATTCAATCAGAGCGTACTC
AAATTGATGGAGCAGAATGCAGCACATGCACCGTATTATCGGCCAGATGA
TACGTAC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy