Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap tRNA-Met-2 tRNA-Arg-2 tRNA-Asp-1 tRNA-Pro-1 IGR420 IGR421 IGR419 IGR422 TP0583 TP0587 ptsH, - TP0589 TP0588 ptsK, - TP0591 TP0582 TP0592 opp,dpp, - TP0585 leuS, - TP0586 TP0583 TP0587 ptsH, - TP0589 TP0588 ptsK, - TP0591 TP0582 TP0592 opp,dpp, - TP0585 leuS, - TP0586 Type: tandem, Name:  - 135 Type: tandem, Name:  - 132 Type: tandem, Name:  - 133 Type: tandem, Name:  - 134 TP0583 TP0588 ptsK, - TP0591 TP0590 ptsH, - TP0589 TP0587 TP0590 TP0592 opp,dpp, - TP0585 leuS, - TP0586 TP0584 TP0584 TP0582
* Calculated from Protein Sequence

Gene ID: TP0586

DNA Molecule Name:
1  

Genbank ID:
3322882

Gene Name:
leuS  

Definition:
leucyl-tRNA synthetase

Gene Start:
636980

Gene Stop:
639613

Gene Length:
2634

Molecular Weight*:
98987

pI*:
7.93

Net Charge*:
10.33

EC:
6.1.1.4  

Functional Class:
Translation; Amino acyl tRNA synthetases  

Pathway: pathway table
Metabolism of macromolecules; Aminoacyl-tRNA biosynthesis

Comment:
Reaction:
ATP + L-LEUCINE + TRNA(LEU) = AMP + PYROPHOSPHATE + L-LEUCYL-TRNA(LEU).

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to leucyl-tRNA synthetases.
For example residues 1-877 are 50% similar to leucine tRNA synthetase
of Bacillus subtilis,(AF008220).

COGS Summary:  COGS Search
BeTs to 14 clades of COG0495
COG name: Leucyl-tRNA synthetase
Functional Class:  J
The phylogenetic pattern of COG0495 is amtkYQvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 213-222 represent a significant (99%) hit to block BL00675D,
Sigma-54 interaction domain proteins ATP-binding region A proteins.

ProDom Summary:  Protein Domain Search
Residues 51-161 are 72% similar to leucyl-tRNA synthetas of SYL_BACSU.
Residues 85-173, 218-316, 256-365, 322-360, 391-437, 512-566, and
649-673 also support this match.

Paralogs:  Local Blast Search
This protein is paralogously related to TP1035, valyl-tRNA
synthetase, TP0452, isoleucyl-tRNA synthetase, and TP0798
methionyl-tRNA synthetase. Residues 3-878 are 48% similar to
TP1035 and residues 23-830 are 21% similar to TP0452. Residues
5-173 are 30% similar and 437-660 are 25% similar to TP0452.

Pfam Summary:  Pfam Search
Residues 11 to 674 (E-value = 1.4e-142) place TP0586 in the tRNA-synt_1 family which is described as tRNA synthetases class I (I, L, M and V) (PF00133)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
253  
323

PDB Hit:
none

Gene Protein Sequence:
MGYPFRALEKKWQAYWRDKRVFCVSEDERFPPERRAYVLDMFPYPSAQGL
HVGHPEGYTATDIYCRYLRMGGYNVLHPMGFDAFGLPAENFALKTGTHPR
VSTSANCDTFRRQIQSFGFSYDWEREISTADPEYYRWTQWLFLKLYEKGL
AYEATAPINWCPSCKTGLANEEVRDACCERCGAEVTRRGVRQWMVRITAY
AERLLSDLDELDWPESVKQMQRNWIGKSCGAEIDFPVDAPACSVHDKLPQ
TIRVYTTRADTLFGVTYLVLAPEHEAVTALTTHAQRAAVQAYVQRAAKKN
DLERTDLAKEKTGVFTGAYVRNPINDMRIPVWVGDYVLVSYGTGAVMAVP
AHDQRDWDFATRFGLPKLTVVSADYTATVPNSNSPQGAVLQRCVSDEGFV
VNSGAFNGLASADARERIVAHLEMRGAGARRVTYRLRDWVFSRQRYWGEP
IPLVHCPSCGVVPLPESALPLLLPETADFTPTEDGQGPLARARTWLRVPC
PQCASDAVRETNTMPQWAGSCWYYLRYMDPRNKTAFCAPEKERYWAPVAL
YVGGAEHAVLHLLYARFWHKVLYDLGLVSTKEPFARLVNQGMITSYAYRR
KNGALVPHDEVHTNAQGTYVHARTGEKLECVVAKMSKALKNVVNPDDMIA
AYGADACRVYEMFMGPLEASKPWNTQGLVGVFRFLEKIWVLAGRVAAANG
IPQDSRAEPPGDLHAQKKSCSMYALETLLHRTIQKVTDDTSALSFNTAIS
QMMIFVNEATRVARRMPLPSKMWEMFVKILSPYAPHLAEELWEMCGHTHT
IAYEPWPQVDPARVAPHVCSVVVQVNGKVRDTFSVAPNAPNEELEQKARE
TAGARKFLGTQQPKRVVIVPNKLVNFVL

Gene Nucleotide Sequence:  Sequence Viewer
ATGGGGTATCCGTTTCGCGCTCTAGAGAAAAAATGGCAGGCCTATTGGCG
CGACAAGCGCGTCTTTTGTGTGTCCGAGGATGAGCGCTTCCCTCCTGAGC
GGCGTGCGTACGTGTTGGACATGTTTCCCTATCCTTCAGCGCAGGGACTT
CACGTCGGACATCCAGAAGGCTACACTGCAACTGATATTTACTGCCGCTA
CTTGCGCATGGGTGGTTACAACGTGCTCCACCCTATGGGTTTTGATGCCT
TCGGACTTCCGGCAGAAAACTTTGCACTCAAAACTGGTACTCATCCGCGC
GTCTCCACCTCCGCCAACTGCGACACCTTTCGCAGACAGATCCAGTCGTT
TGGTTTTTCCTACGATTGGGAACGTGAAATATCTACCGCAGATCCAGAAT
ACTATCGCTGGACTCAGTGGCTGTTCCTCAAACTTTATGAAAAAGGATTA
GCCTATGAAGCAACCGCGCCCATCAATTGGTGTCCCAGCTGCAAAACAGG
CCTTGCAAACGAAGAAGTAAGAGACGCGTGCTGCGAGCGCTGTGGTGCTG
AGGTGACGCGGCGTGGTGTCCGCCAGTGGATGGTGCGTATTACAGCGTAT
GCCGAGCGTCTCCTTTCAGATTTAGATGAACTTGACTGGCCTGAGTCAGT
TAAACAAATGCAGCGTAATTGGATTGGAAAAAGCTGCGGCGCGGAAATTG
ACTTTCCCGTAGATGCGCCTGCGTGTTCAGTGCACGATAAGCTACCACAG
ACAATTCGCGTGTACACCACGCGTGCGGACACGCTTTTTGGAGTAACGTA
CCTGGTACTTGCTCCCGAGCATGAAGCGGTAACGGCGCTCACTACACACG
CACAACGCGCAGCGGTACAGGCGTACGTGCAACGTGCAGCAAAAAAGAAC
GATCTCGAACGCACTGATTTAGCGAAGGAAAAGACCGGTGTTTTCACCGG
CGCGTACGTGCGCAATCCAATCAATGATATGCGCATACCGGTGTGGGTAG
GTGATTATGTGCTCGTTTCCTACGGCACGGGGGCAGTGATGGCAGTTCCT
GCACATGATCAGCGCGACTGGGATTTTGCCACTCGGTTTGGCTTACCCAA
GTTAACCGTGGTGTCTGCAGACTACACTGCAACAGTTCCTAATAGCAACT
CCCCTCAAGGCGCGGTACTCCAAAGATGCGTCTCAGACGAGGGTTTTGTC
GTCAACTCTGGAGCTTTCAATGGTCTTGCTAGTGCCGACGCGCGAGAACG
TATTGTTGCCCATCTTGAAATGCGTGGCGCAGGTGCACGGCGCGTCACCT
ATCGCCTACGCGACTGGGTGTTCAGCCGTCAGCGCTATTGGGGAGAACCC
ATCCCTCTTGTGCACTGTCCTTCCTGCGGTGTTGTACCTCTCCCTGAGAG
TGCGCTGCCGCTTTTGTTACCCGAAACCGCCGATTTCACTCCCACGGAAG
ATGGGCAGGGCCCCCTTGCACGAGCGCGCACGTGGCTGCGCGTTCCCTGT
CCGCAGTGTGCATCTGACGCAGTGCGAGAAACAAACACAATGCCCCAGTG
GGCAGGATCCTGCTGGTATTACCTCCGTTATATGGACCCCCGCAATAAGA
CTGCCTTTTGTGCACCCGAGAAGGAGCGTTACTGGGCGCCAGTGGCGTTA
TATGTAGGTGGTGCAGAGCACGCCGTACTGCATTTACTGTATGCACGCTT
TTGGCACAAGGTATTGTACGACTTAGGTCTTGTAAGCACGAAAGAGCCCT
TTGCGCGGTTGGTGAACCAAGGCATGATTACGTCGTATGCATATCGCAGG
AAAAATGGCGCGCTTGTACCTCACGACGAGGTGCACACTAATGCTCAAGG
TACCTACGTGCATGCTCGTACGGGGGAAAAACTCGAGTGCGTTGTGGCAA
AAATGTCAAAAGCGTTAAAGAATGTCGTCAATCCTGATGACATGATTGCA
GCGTACGGTGCTGACGCGTGCCGGGTATACGAGATGTTCATGGGACCTCT
TGAGGCTTCCAAACCGTGGAATACGCAGGGGTTAGTGGGGGTTTTTCGGT
TTTTAGAAAAAATTTGGGTACTTGCGGGGCGCGTGGCGGCCGCAAACGGT
ATTCCACAAGACTCTCGTGCAGAGCCGCCAGGTGACCTGCACGCACAGAA
AAAGTCTTGCAGCATGTACGCCCTCGAAACGCTGTTACACCGGACTATTC
AAAAAGTGACCGACGATACGTCGGCGCTTAGTTTTAACACGGCAATCAGT
CAGATGATGATATTTGTAAATGAGGCTACGCGGGTGGCGCGGAGGATGCC
TCTTCCCTCTAAAATGTGGGAGATGTTTGTAAAAATCCTCTCTCCCTATG
CACCACATTTGGCAGAAGAACTCTGGGAAATGTGTGGGCACACGCACACT
ATCGCATATGAGCCTTGGCCACAGGTGGACCCTGCGCGTGTGGCGCCGCA
TGTGTGCTCCGTAGTGGTGCAGGTGAACGGTAAAGTGCGCGACACCTTCT
CCGTAGCGCCGAACGCTCCAAATGAGGAACTCGAGCAAAAGGCGCGGGAA
ACCGCCGGTGCGCGTAAGTTTCTTGGTACGCAGCAGCCAAAGCGCGTAGT
GATAGTTCCCAATAAATTAGTAAATTTCGTTCTG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy