Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR771 IGR1 IGR770 IGR772 IGR767 IGR2 IGR768 IGR769 IGR1.1 TpF1, - TP1038 clpP, - TP1041 hlyIII, - TP1037 lysS, - TP1040 apt, - TP1039 recF, - TP0003 dnaA, - TP0001 TP1036 gyrA, - TP0005 TpF1, - TP1038 clpP, - TP1041 hlyIII, - TP1037 lysS, - TP1040 apt, - TP1039 recF, - TP0003 dnaA, - TP0001 TP1036 gyrA, - TP0005 Type: tandem, Name:  - 4 Type: tandem, Name:  - 1 Type: tandem, Name:  - 225 Type: tandem, Name:  - 2 Type: tandem, Name:  - 3 Type: tandem, Name:  - 5 TpF1, - TP1038 clpP, - TP1041 hlyIII, - TP1037 lysS, - TP1040 apt, - TP1039 recF, - TP0003 dnaA, - TP0001 TP1036 gyrA, - TP0005 TP0004 dnaN, - TP0002 TP0004 dnaN, - TP0002
* Calculated from Protein Sequence

Gene ID: TP0575A

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ptsI  

Definition:
phosphoenolpyruvate-protein phosphotransferase (authentic frameshift - uncorrected)

Gene Start:
0

Gene Stop:
0

Gene Length:
0

Molecular Weight*:
0

pI*:
0.00

Net Charge*:
0.00

EC:
2.7.3.9  

Functional Class:
Regulatory functions  

Pathway: pathway table

Comment:
This protein is a component of the PTS, a major carbohydrate transport
system.

Reaction:
PHOSPHOENOLPYRUVATE + PROTEIN HISTIDINE =
PYRUVATE + PROTEIN N-PHOSPHOHISTIDINE.

Note: This protein appears to have a frameshift. The
sequence shown here is based on the DNA alone. See TP0575 for the
proposed corrected sequence. The shift seems to occur at position 645.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to phosphoenolpyruvate-
protein phosphotransferase proteins. For example residues 11-179 are
27% similar to PT1_STRMU, phosphoenolpyruvate-protein phosphotransferase
of Streptococcus mutans,(L15191).

COGS Summary:  COGS Search
BeTs to 3 clades of COG1080
COG name: Phosphoenolpyruvate-protein kinase (PTS system EI component in bacteria)
Functional Class:  G
The phylogenetic pattern of COG1080 is --------Eb-h--gpo-in-
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
Residues 112-124 represent a significant (98%) hit to block PR00696E,
CROSSOVER JUNCTION ENDODEOXYRIBONUCLEASE RUVC SIGNATURE.

ProDom Summary:  Protein Domain Search
Residues 48-146 are 33% similar to phosphoenolpyruvate-protein
phosphotransferase as represented by YCGC_ECOLI, a hypothetical
protein with similarity to phosphoenolpyruvate-protein phosphotransferase.
Residues 155-179 also support this match.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 11 to 141 (E-value = 1.9e-17) place TP0575A in the PEP-utilisers_N family which is described as PEP-utilising enzyme, N-terminal (PF05524)

PDB Hit:
none

Gene Protein Sequence:
MLRAMRTIPPITGIIASAGCAIGPVFCFDTLLPTRSRPGGSRLRPPSQEI
ARLRNALSYARASLQNLLDSVRAKASGDEPAPEYAVLSGQAEMLADAAFI
ATVEETLRSCSCDAETALRKAITHVTDALSATSDEYLRARAADIRDAFSG
VFDALAHDTTPTAGSSLPTQGIGNSTPHSPWELTLAPFPQDPSWLPLTYN
LRTHCACTRQISLVW

Gene Nucleotide Sequence:  Sequence Viewer
ATGCTCAGAGCCATGCGCACCATTCCCCCTATCACCGGCATTATTGCCTC
AGCAGGATGCGCCATCGGTCCAGTCTTTTGCTTCGATACCCTGCTACCTA
CCCGCTCCCGCCCTGGCGGATCCCGCCTGCGCCCCCCATCGCAGGAAATT
GCCCGCTTGCGCAACGCACTTTCATATGCGCGCGCCTCGCTGCAGAACCT
GCTCGATTCAGTGCGCGCAAAAGCATCCGGAGACGAGCCTGCACCCGAGT
ATGCCGTGCTCAGTGGCCAAGCAGAAATGCTGGCCGACGCGGCCTTCATA
GCTACCGTAGAGGAAACGCTGCGCTCTTGTTCCTGCGATGCAGAAACTGC
TTTGCGCAAGGCAATTACCCACGTGACAGATGCCCTCTCTGCTACCTCAG
ACGAGTACCTGCGTGCCCGGGCAGCCGATATCCGAGACGCGTTTAGCGGT
GTCTTCGACGCACTTGCGCATGACACCACACCCACCGCAGGAAGCTCTTT
GCCAACACAAGGGATTGGAAATAGCACCCCACACTCCCCCTGGGAGCTGA
CTTTAGCGCCGTTCCCCCAGGATCCATCGTGGTTGCCGCTCACGTACAAC
CTGCGCACGCACTGCGCCTGCACGAGGCAAATATCGCTGGTTTGGTAACC
GAAGGTGGCAGCGTAACAAGCCATGTCGCCATCATGGCGCGCGCGTGGAG
TCTTCCCCTGCTCGTCAGTGCACAGGGATGTAAAGACGTTGCACAGTACG
TGCTCCGTGTGCGGCAAACTGCTCGTGCCACCGATGAGGCGCTGCGCGCA
CTCCTCGATGCTGAAAGCAGTGGGGGAAAAACTGACGCTCTAGGAACCCT
CACCGTAAATCCCGACGTGCGCGCGCTGCGCACGCGCATGCCTCACCCTT
TCCTCACCGTCAAACACACCAGTACAGCTGAACAGAGTCCCCCGGCCGCC
TGTGTGCTAAACGCACCGCTGCGCACTTACTCAAGTGACGGTATCCGTTT
TGAAGTCGGGGCAAATATCGTTATGCCCCAGGAAGCGTGTGCAGCTGCTG
CGCTCGGAGCAGCAGGCATCGGACTGTTCCGTTCGGAGTTCTTGCTATTC
GGATCCGACCGCTTCCCAGATGAAGAGACGCAGTGCTCTGCCTACACGCG
CGCGCTGCAGGCAATGAGAGGACTCCCCGTCGTGCTTCGAACGTTTGACC
TTGGTGCAGACAAACTGGTGCCAGACCCTGCGCGAATGTGCGCACTCTCG
GACGCTGCTGAACCGTGTGCACACACCGCTTCGGAGCGCAATCCTCTTTT
AGGGTTACGAGGCATCCGCTACTGCCTCGCACATCCTGAGCTCCTGAAAG
TGCAGCTTCGTGCAATGCTCCGCGCCGGAGCGTGCGCAACATGTGCAGAA
GGGACGCTGCGCATTCTCATCCCCATGGTTTCACGGGTGGAAGAAATTCA
CGCCGTCGCCGACCTCATCTCTGAGGTAGCCGACGAGTGTGCCCGCGCGC
ACGTGAGTACACCCGATCGGGTAGCACTCGGCATTATGATCGAAACGCCC
GCTTCGGCACTGATGGCAGCAGACTTCGCTCCCCACGTGGATTTTTTTTC
CATAGGGACGAACGACTTAACCCAGTACGTGTTCGCCGCCGATCGAGAAA
ACGAACAGGTCAGCAGCTATGCCGATTACTTCCACCCGGCACTCCTCCGT
CTTATCCAGCACGTAATACATGCGCACAGACATCTGCGGCAACGTCCCGG
TATTTCTTTTGGAGAACAGGGAATCGGACGCGTGGTCATGTGCGGCGCCA
TGGCTGAAGATGAAACTGCGCTCTTTCTTCTGGCGGGGCTCGGCCTGCGA
GCGTTGAGTGTGCCTTCTTCACGCATCGAGACGCTGCACACGTTCTTATC
ACGCATTTCAGTCTCTGATGCAGAGCACTGTGCACGTGCAGCCGTGCAGC
TTTCAGATGCGCAGTCAGTCCGCACACTCATCGAAGAACATCTGCGCACC
GCAGGTATTACGCTTGAGAAAGACGAGGAAGAACCCTCACCCCCTCGATC
CCCA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy