Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR418 IGR414 IGR413 IGR415 IGR417 IGR416 Tp70,lemA, - TP0571 TP0570 TP0572 TP0574 TP0573 TP0579 ftsY, - TP0578 TP0577 ptsI, - TP0575 Tp70,lemA, - TP0571 TP0570 TP0572 TP0574 TP0573 TP0579 ftsY, - TP0578 TP0577 ptsI, - TP0575 Type: tandem, Name:  - 127 Type: tandem, Name:  - 128 Type: tandem, Name:  - 129 Tp70,lemA, - TP0571 TP0570 TP0572 TP0574 TP0573 ftsY, - TP0578 TP0577 ptsI, - TP0575 prfB, - TP0576 prfB, - TP0576 TP0579
* Calculated from Protein Sequence

Gene ID: TP0575

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ptsI  

Definition:
phosphoenolpyruvate-protein phosphotransferase (authentic frameshift - corrected)

Gene Start:
623682

Gene Stop:
625735

Gene Length:
0

Molecular Weight*:
0

pI*:
0.00

Net Charge*:
0.00

EC:
2.7.3.9  

Functional Class:
Regulatory functions  

Pathway: pathway table

Comment:
This protein is a component of the PTS, a major carbohydrate transport
system.

Reaction:
PHOSPHOENOLPYRUVATE + PROTEIN HISTIDINE =
PYRUVATE + PROTEIN N-PHOSPHOHISTIDINE.

Note: This protein appears to have a frameshift. The beginning
of the frameshift is designated with '-' in the DNA sequence. The
sequence shown here is the proposed corrected seqeunce. See TP0575A
for the uncorrected sequence.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to phosphoenolpyruvate-
protein phosphotransferase proteins. For example residues 11-663 are
28% similar to PT1_BACSU, phosphoenolpyruvate-protein phosphotransferase
of Bacillus subtilis,(M98359).

COGS Summary:  COGS Search
BeTs to 5 clades of COG1080
COG name: Phosphoenolpyruvate-protein kinase (PTS system EI component in bacteria)
Functional Class:  G
The phylogenetic pattern of COG1080 is --------Eb-h--gpo-in-
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
Residues 16-23, 214-240, 353-366, 429-455, 472-482, 513-551, 541-579,
and 578-622 represent significant (100%) hits to blocks BL00370A,B,C,D,E,F,G,
PEP-utilizing enzymes phosphorylation site proteins proteins. Residues
112-124 represent a significant (98%) hit to block PR00696E, CROSSOVER
JUNCTION ENDODEOXYRIBONUCLEASE RUVC SIGNATURE. Residues 342-356,
415-429, 345-356, 418-427, 345-354, and 346-355 represent significant
hits to blocks PR00308A,B,C, TYPE I ANTIFREEZE PROTEIN SIGNATURE.

ProDom Summary:  Protein Domain Search
Residues 418-642 are 37% similar to phosphoenolpyruvate-protein
phosphotransferase as represented by PT1_BACSU. Residues
48-146, 198-243, 333-370, and 535-548 also support matches to
phosphoenolpyruvate-protein phosphotransferases.

Paralogs:  Local Blast Search
This protein is paralogously related to TP0746, pyruvate phosphate
dikinase. Residues 334-551 are 28% similar to TP0746.

Pfam Summary:  Pfam Search
Residues 11 to 141 (E-value = 1.9e-17) place TP0575 in the PEP-utilisers_N family which is described as PEP-utilising enzyme, N-terminal (PF05524)
Residues 313 to 638 (E-value = 5.8e-90) place TP0575 in the PEP-utilizers_C family which is described as PEP-utilising enzyme, TIM barrel domain (PF02896)

PDB Hit:
none

Gene Protein Sequence:
MLRAMRTIPPITGIIASAGCAIGPVFCFDTLLPTRSRPGGSRLRPPSQEI
ARLRNALSYARASLQNLLDSVRAKASGDEPAPEYAVLSGQAEMLADAAFI
ATVEETLRSCSCDAETALRKAITHVTDALSATSDEYLRARAADIRDAFSG
VFDALAHDTTPTAGSSLPTQGIGNSTPHSPWELTLAPFPQDPSWLPLTYN
LRTHCACTRQISLVWXTEGGSVTSHVAIMARAWSLPLLVSAQGCKDVAQY
VLRVRQTARATDEALRALLDAESSGGKTDALGTLTVNPDVRALRTRMPHP
FLTVKHTSTAEQSPPAACVLNAPLRTYSSDGIRFEVGANIVMPQEACAAA
ALGAAGIGLFRSEFLLFGSDRFPDEETQCSAYTRALQAMRGLPVVLRTFD
LGADKLVPDPARMCALSDAAEPCAHTASERNPLLGLRGIRYCLAHPELLK
VQLRAMLRAGACATCAEGTLRILIPMVSRVEEIHAVADLISEVADECARA
HVSTPDRVALGIMIETPASALMAADFAPHVDFFSIGTNDLTQYVFAADRE
NEQVSSYADYFHPALLRLIQHVIHAHRHLRQRPGISFGEQGIGRVVMCGA
MAEDETALFLLAGLGLRALSVPSSRIETLHTFLSRISVSDAEHCARAAVQ
LSDAQSVRTLIEEHLRTAGITLEKDEEEPSPPRSP

Gene Nucleotide Sequence:  Sequence Viewer
ATGCTCAGAGCCATGCGCACCATTCCCCCTATCACCGGCATTATTGCCTC
AGCAGGATGCGCCATCGGTCCAGTCTTTTGCTTCGATACCCTGCTACCTA
CCCGCTCCCGCCCTGGCGGATCCCGCCTGCGCCCCCCATCGCAGGAAATT
GCCCGCTTGCGCAACGCACTTTCATATGCGCGCGCCTCGCTGCAGAACCT
GCTCGATTCAGTGCGCGCAAAAGCATCCGGAGACGAGCCTGCACCCGAGT
ATGCCGTGCTCAGTGGCCAAGCAGAAATGCTGGCCGACGCGGCCTTCATA
GCTACCGTAGAGGAAACGCTGCGCTCTTGTTCCTGCGATGCAGAAACTGC
TTTGCGCAAGGCAATTACCCACGTGACAGATGCCCTCTCTGCTACCTCAG
ACGAGTACCTGCGTGCCCGGGCAGCCGATATCCGAGACGCGTTTAGCGGT
GTCTTCGACGCACTTGCGCATGACACCACACCCACCGCAGGAAGCTCTTT
GCCAACACAAGGGATTGGAAATAGCACCCCACACTCCCCCTGGGAGCTGA
CTTTAGCGCCGTTCCCCCAGGATCCATCGTGGTTGCCGCTCACGTACAAC
CTGCGCACGCACTGCGCCTGCACGAGGCAAATATCGCTGGTTTGG-TAAC
CGAAGGTGGCAGCGTAACAAGCCATGTCGCCATCATGGCGCGCGCGTGGA
GTCTTCCCCTGCTCGTCAGTGCACAGGGATGTAAAGACGTTGCACAGTAC
GTGCTCCGTGTGCGGCAAACTGCTCGTGCCACCGATGAGGCGCTGCGCGC
ACTCCTCGATGCTGAAAGCAGTGGGGGAAAAACTGACGCTCTAGGAACCC
TCACCGTAAATCCCGACGTGCGCGCGCTGCGCACGCGCATGCCTCACCCT
TTCCTCACCGTCAAACACACCAGTACAGCTGAACAGAGTCCCCCGGCCGC
CTGTGTGCTAAACGCACCGCTGCGCACTTACTCAAGTGACGGTATCCGTT
TTGAAGTCGGGGCAAATATCGTTATGCCCCAGGAAGCGTGTGCAGCTGCT
GCGCTCGGAGCAGCAGGCATCGGACTGTTCCGTTCGGAGTTCTTGCTATT
CGGATCCGACCGCTTCCCAGATGAAGAGACGCAGTGCTCTGCCTACACGC
GCGCGCTGCAGGCAATGAGAGGACTCCCCGTCGTGCTTCGAACGTTTGAC
CTTGGTGCAGACAAACTGGTGCCAGACCCTGCGCGAATGTGCGCACTCTC
GGACGCTGCTGAACCGTGTGCACACACCGCTTCGGAGCGCAATCCTCTTT
TAGGGTTACGAGGCATCCGCTACTGCCTCGCACATCCTGAGCTCCTGAAA
GTGCAGCTTCGTGCAATGCTCCGCGCCGGAGCGTGCGCAACATGTGCAGA
AGGGACGCTGCGCATTCTCATCCCCATGGTTTCACGGGTGGAAGAAATTC
ACGCCGTCGCCGACCTCATCTCTGAGGTAGCCGACGAGTGTGCCCGCGCG
CACGTGAGTACACCCGATCGGGTAGCACTCGGCATTATGATCGAAACGCC
CGCTTCGGCACTGATGGCAGCAGACTTCGCTCCCCACGTGGATTTTTTTT
CCATAGGGACGAACGACTTAACCCAGTACGTGTTCGCCGCCGATCGAGAA
AACGAACAGGTCAGCAGCTATGCCGATTACTTCCACCCGGCACTCCTCCG
TCTTATCCAGCACGTAATACATGCGCACAGACATCTGCGGCAACGTCCCG
GTATTTCTTTTGGAGAACAGGGAATCGGACGCGTGGTCATGTGCGGCGCC
ATGGCTGAAGATGAAACTGCGCTCTTTCTTCTGGCGGGGCTCGGCCTGCG
AGCGTTGAGTGTGCCTTCTTCACGCATCGAGACGCTGCACACGTTCTTAT
CACGCATTTCAGTCTCTGATGCAGAGCACTGTGCACGTGCAGCCGTGCAG
CTTTCAGATGCGCAGTCAGTCCGCACACTCATCGAAGAACATCTGCGCAC
CGCAGGTATTACGCTTGAGAAAGACGAGGAAGAACCCTCACCCCCTCGAT
CCCCA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy