Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR408 IGR414 IGR412 IGR413 IGR415 IGR409 IGR410 IGR411 TP0567 eda, - TP0568 Tp70,lemA, - TP0571 TP0570 TP0572 TP0565 TP0574 algI, - TP0566 pepP, - TP0569 TP0573 TP0567 eda, - TP0568 Tp70,lemA, - TP0571 TP0570 TP0572 TP0565 TP0574 algI, - TP0566 pepP, - TP0569 TP0573 Type: tandem, Name:  - 125 Type: tandem, Name:  - 126 TP0567 eda, - TP0568 Tp70,lemA, - TP0571 TP0570 TP0572 TP0565 TP0574 algI, - TP0566 pepP, - TP0569 TP0573
* Calculated from Protein Sequence

Gene ID: TP0569

DNA Molecule Name:
1  

Genbank ID:
3322861

Gene Name:
pepP  

Definition:
aminopeptidase P

Gene Start:
619494

Gene Stop:
617173

Gene Length:
2322

Molecular Weight*:
83717

pI*:
7.04

Net Charge*:
0.51

EC:
3.4.11.9  

Functional Class:
Translation; Degradation of proteins, peptides, and glycopeptides  

Pathway: pathway table
Miscellaneous Enzymes

Comment:
Reaction:
RELEASE OF ANY N-TERMINAL AMINO ACID, INCLUDING PROLINE, THAT IS
LINKED WITH PROLINE, EVEN FROM A DIPEPTIDE OR TRIPEPTIDE.


Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several siginficant hits to aminopeptidase P
proteins. For example residues 374-748 are 31% similar and residues
36-299 are 27% similar to cytoplasmic aminopeptidase P of Rattus
norvegicus,(AF038591). In addition to many eukaryotic hits residues
415-760 are 31% similar and residues 32-287 are 26% similar to a
peptidase of Borrelia burgdorferi,(AE001119).

COGS Summary:  COGS Search
BeTs to 17 clades of COG0006
COG name: Xaa-Pro aminopeptidase
Functional Class:  E
The phylogenetic pattern of COG0006 is amtKYqvcEBRhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 483-494, 593-605, 645-659, and 664-677 represent significant
(100%) hits to blocks BL00491A,B,C,D, Aminopeptidase P and proline
dipeptidase proteins.

ProDom Summary:  Protein Domain Search
Residues 523-616 are 40% similar to a region of YQHT_BACSU, a
putative peptidase. Residues 35-107 also support a match to peptidases.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
484  
603

PDB Hit:
none

Gene Protein Sequence:
MIPLGKRHGHSAVAVCSRGVSVFRGEKAMDGVRGRLSALRSLMRAQGVDI
CYISGENAHGQIDGAREYFSGFTGSAGIVVVTAQRAFLWTDGRYFIQAER
ELSACEVCLFRTGQAGVPRVTELLRTELRAFSSGPGHGGGTLAVDGRTIS
AAVWEQFQQELVDVSLRLDFDGALLLPQEHRVSVVPSPAFLLDERYTGLS
AAQKLTQLRAALSARSCDATVLSTLDDVCWLTNVRAHDVPCTPLLVAYMV
VTHTRAFLYVDMRKISSALHQALYAQGVECMPYDTFFDQVCARCADQEPT
VHAVGKGRAGVQEVAGRTPVVLLDFERSCAALVDLFRASPQVCRPQVERS
APSGSLSSVLGIEEDGTETSRGGKSACALQSARDALAAGKEKENKEERGQ
TMCFSVCRGLLPTVALKALKNDTERANVHQAMIQDGIALVKTLQWVYQQL
DVGADVDECAVAEFVRAARAVSPSFIEESFHTIAGYGANAAMVHYRPVRF
SALHPAAGQTAALLRARGFLLLDSGAHYREGTTDVTRTLALGPLTDVQRA
DYTLVLQAHSALARARFPAGTSGAVLDGIARAPLWAQGRDYPHGTGHGVG
FCLSVHEGPYSISPSAPGRGGTARGIGAEHTGDPPFFSEEAAWQLRPGML
LSNEPGVYVAGSHGVRIENLMWVVQAHESDAQCVWKEGGEGKEENAAARE
CTGADRMQPSRCRSFYGFQTATLCPIDTRPLVRERLHDEDIAWLNAYHLR
VYVTLAPFLDARTRAFLRTCCRAL

Gene Nucleotide Sequence:  Sequence Viewer
GTGATTCCACTAGGTAAGCGGCATGGGCATTCTGCTGTGGCCGTGTGTTC
GCGGGGTGTTTCTGTGTTCAGAGGAGAGAAGGCGATGGATGGGGTGCGGG
GGCGCCTGAGTGCCCTGCGTTCGCTGATGCGTGCGCAAGGGGTAGATATT
TGTTATATCTCCGGTGAGAACGCGCATGGGCAGATAGATGGTGCGCGTGA
ATATTTTTCTGGATTTACAGGCTCTGCAGGAATAGTGGTGGTGACCGCAC
AACGTGCGTTTTTGTGGACAGATGGACGGTATTTTATCCAGGCTGAGCGT
GAGCTGTCGGCATGTGAAGTGTGCCTTTTTCGTACAGGGCAGGCGGGCGT
ACCTCGGGTAACTGAGCTTTTGCGTACAGAACTCCGTGCTTTTTCATCCG
GGCCTGGGCACGGAGGGGGAACGCTCGCAGTGGATGGCCGTACGATTTCT
GCGGCTGTATGGGAGCAGTTTCAGCAGGAGCTTGTGGATGTATCGCTTCG
CCTAGACTTTGATGGGGCGCTCCTGCTACCGCAGGAGCATCGCGTTTCCG
TAGTTCCTTCCCCTGCGTTTTTGTTGGATGAGCGCTACACGGGGTTGAGT
GCGGCGCAAAAGCTCACCCAACTGCGCGCAGCGCTCAGTGCACGCAGCTG
TGATGCAACGGTGTTGTCCACATTGGATGATGTGTGCTGGCTCACCAATG
TGCGCGCACACGATGTGCCGTGTACACCGCTGTTGGTGGCATACATGGTC
GTCACGCACACCCGTGCCTTTCTTTATGTGGATATGCGCAAAATTTCTTC
TGCATTGCATCAAGCTTTGTATGCGCAGGGCGTTGAGTGTATGCCGTACG
ATACTTTTTTTGATCAGGTGTGTGCGCGCTGTGCGGATCAGGAACCGACG
GTACATGCTGTGGGGAAAGGAAGAGCAGGAGTGCAGGAAGTGGCAGGCAG
AACGCCAGTGGTGTTGTTGGACTTTGAGCGTTCGTGTGCTGCACTGGTGG
ATCTCTTTCGTGCATCGCCGCAGGTGTGTAGACCGCAGGTGGAACGATCC
GCTCCTTCCGGTTCGTTATCTTCTGTGCTGGGCATAGAAGAGGATGGTAC
TGAGACCAGCAGAGGTGGGAAAAGTGCATGTGCGTTGCAGTCTGCACGCG
ACGCTCTGGCAGCAGGGAAAGAAAAGGAGAACAAAGAGGAGCGGGGACAG
ACCATGTGCTTCTCCGTTTGTCGTGGACTTTTGCCAACTGTAGCGCTCAA
AGCATTAAAGAACGACACCGAGCGAGCCAATGTGCACCAGGCAATGATAC
AGGATGGGATTGCGCTGGTAAAAACGCTGCAGTGGGTGTACCAGCAGCTT
GACGTGGGTGCAGACGTTGATGAATGCGCTGTAGCGGAGTTTGTACGTGC
TGCCCGGGCGGTGTCTCCGTCTTTCATTGAAGAAAGCTTTCACACCATTG
CAGGATACGGGGCGAACGCAGCAATGGTGCATTACCGCCCCGTGCGTTTT
TCAGCTTTACACCCTGCTGCGGGTCAAACGGCAGCACTGCTTCGCGCGCG
TGGTTTTTTATTATTGGATTCTGGCGCGCATTATCGTGAGGGTACCACCG
ATGTGACGCGCACGCTGGCTCTCGGTCCTTTGACAGATGTGCAGCGTGCA
GACTACACGCTGGTATTGCAGGCGCACAGTGCGCTTGCGCGTGCGCGCTT
TCCTGCAGGGACCAGTGGGGCGGTGCTCGACGGAATTGCCCGGGCTCCGC
TGTGGGCACAGGGACGAGACTACCCACATGGGACGGGGCATGGGGTGGGT
TTTTGTCTTTCAGTGCATGAGGGTCCCTATAGTATTTCTCCGAGTGCTCC
CGGGAGAGGAGGAACTGCACGAGGCATTGGGGCAGAGCACACGGGAGATC
CTCCCTTTTTTTCTGAGGAGGCGGCGTGGCAGCTGCGCCCGGGTATGCTC
CTTTCCAATGAGCCTGGGGTGTATGTGGCTGGCTCTCATGGCGTGCGCAT
AGAAAATCTTATGTGGGTGGTACAGGCGCATGAGTCTGACGCGCAGTGTG
TGTGGAAGGAAGGAGGGGAGGGAAAGGAGGAGAACGCGGCGGCGCGTGAG
TGTACGGGTGCAGATAGGATGCAACCGTCACGATGCCGAAGTTTCTATGG
ATTTCAAACTGCAACGCTGTGTCCAATTGACACGCGGCCGCTCGTGCGAG
AACGATTGCACGATGAAGATATTGCGTGGCTGAATGCCTATCACCTACGG
GTGTATGTAACGCTCGCGCCGTTTTTAGATGCGCGTACGCGCGCCTTTTT
GCGCACGTGCTGTCGTGCGCTA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy