Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR403 IGR405 IGR404 IGR402 IGR406 IGR407 TP0561 asnA, - TP0556 tktA, - TP0560 TP0557 TP0558 TP0562 TP0559 TP0564 TP0561 asnA, - TP0556 tktA, - TP0560 TP0557 TP0558 TP0562 TP0559 TP0564 Type: tandem, Name:  - 124 Type: tandem, Name:  - 257 TP0561 asnA, - TP0556 tktA, - TP0560 TP0557 TP0558 TP0562 TP0559 TP0564 TP0563 TP0563
* Calculated from Protein Sequence

Gene ID: TP0560

DNA Molecule Name:
1  

Genbank ID:
3322854

Gene Name:
tktA  

Definition:
transketolase

Gene Start:
608379

Gene Stop:
606397

Gene Length:
1983

Molecular Weight*:
71006

pI*:
6.19

Net Charge*:
-8.51

EC:
2.2.1.1  

Functional Class:
Energy metabolism; Pentose phosphate pathway  

Pathway: pathway table
Carbohydrate metabolism; Pentose phosphate cycle
Energy metabolism; Carbon fixation

Secondary Evidence:
Katayama A, Tsujii A, Wada A, Nishino T, Ishihama A.
Systematic search for zinc-binding proteins in Escherichia coli.
Eur J Biochem. 2002 May;269(9):2403-13.
PMID: 11985624

Gosset G, Yong-Xiao J, Berry A.
A direct comparison of approaches for increasing carbon flow to aromatic biosynthesis in Escherichia coli.
J Ind Microbiol. 1996 Jul;17(1):47-52.
PMID: 8987689

de Sury d'Aspremont R, Toussaint B, Vignais PM.
Isolation of Rhodobacter capsulatus transketolase: cloning and sequencing of its structural tktA gene.
Gene. 1996 Feb;169(1):81-4.
PMID: 8635754

Comment:
Reaction:
SEDOHEPTULOSE 7-PHOSPHATE + D-GLYCERALDEHYDE 3-PHOSPHATE =
D-RIBOSE 5-PHOSPHATE + D-XYLULOSE 5-PHOSPHATE.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to transketolases.
For example residues 12-653 are 46% similar to TKT_BACSU, transketolase
of Bacillus subtilis,(Z99113).

COGS Summary:  COGS Search
BeTs to 12 clades of COG0021
COG name: Transketolase
Functional Class:? G
The phylogenetic pattern of COG0021 is -m--YqVCEbrhujgp-lin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 14-30, 58-72, 92-103, 114-129, 148-187, 403-423, 461-496,
and 554-585 represent significant (100%) hits to blocks
BL00801A,B,C,D,E,F,G,H, Transketolase proteins.

ProDom Summary:  Protein Domain Search
Residues 146-484 are 47% similar to transketolase of TKT_HAEIN.
Residues 47-144 and 485-573 also support this match.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 5 to 333 (E-value = 4.4e-172) place TP0560 in the Transketolase_N family which is described as Transketolase, thiamine diphosphate binding domain (PF00456)
Residues 355 to 526 (E-value = 9.3e-65) place TP0560 in the Transket_pyr family which is described as Transketolase, pyridine binding domain (PF02779)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
332  
404
non-globular  
518  
661

PDB Hit:
gi|809440|pdb|1TKA|A Saccharomyces cerevisiae

Gene Protein Sequence:
MTEEAMRAMALSIRSLTIDAIERANSGHPGLPLGAAELAACLYGTILKHN
PANPSWFNRDRFVLSAGHGSMLLYAALHLSGYDVSLEDIKNFRQVGSRCP
GHPEYGCTPGVEATTGPLGQGISMAVGFALAEAMLAARFNTDEHAVVDHH
TYALVGEGCLMEGVASEASSFAGTMRLGKLIVFYDENHISIDGSTDLTFS
EDVAKRYEAYGWQVLRGSMYSYTDIMDLTACAKRDDRPSLIILRSIIGKG
APTVEGSARAHGAPLGEAGVREAKKALGLDPACSFFVAPELTAVLQKRKC
ECAHVEDSWNELFEAWSTQYPEKRADWDAAFVPGGVSTSQLARVVCPHFE
KGSSLATRTASGKVLDALCSVLPNLVGGSADLRGPNAVAVSSLRPFSAEH
RAGGYCYFGVREFAMAAIVNGMQLHGGLRAFGATFMVFSDYFRPALRLAA
LMRIPSVFVLTHDSIFVGEDGPTHQPVETLAALRAIPNVLVLRPADAEET
FEAWKIALLHRSGPVCIVLSRQNVPVFEKSDSSWRSTVEESGAYVVREGG
ATPELTVLASGSEVDLALRAAQLSKRRVRVVSVLCKERFEAAGDEVQRRI
QGGARVVVAEAGVYQGWGAWAKREKCLVLDRFGXSGPGTQVAQALEFTAE
ALVEIILDWLA

Gene Nucleotide Sequence:  Sequence Viewer
ATGACTGAAGAAGCTATGCGCGCGATGGCACTTTCCATCCGCAGTTTGAC
GATAGACGCCATCGAACGGGCGAATTCTGGTCACCCTGGTTTGCCGCTGG
GCGCAGCAGAGCTTGCTGCCTGTTTATATGGGACGATCTTAAAGCATAAT
CCGGCGAATCCTAGCTGGTTTAATCGGGATCGTTTCGTCCTGTCTGCAGG
ACACGGGTCTATGCTCTTGTATGCTGCGCTCCACCTTTCTGGGTACGACG
TTTCGCTTGAGGATATTAAGAACTTTAGGCAGGTAGGCTCCCGGTGTCCT
GGCCATCCTGAATACGGTTGTACCCCCGGTGTGGAAGCAACAACCGGTCC
ATTGGGTCAGGGTATCTCTATGGCGGTGGGTTTTGCGCTTGCAGAGGCAA
TGCTTGCGGCACGTTTTAATACTGATGAGCATGCCGTTGTAGATCACCAC
ACCTATGCGCTTGTGGGGGAAGGCTGCCTTATGGAGGGCGTTGCCTCAGA
GGCTTCTAGCTTTGCCGGCACTATGCGTCTGGGCAAGCTCATCGTTTTTT
ATGATGAGAACCACATCAGCATAGACGGATCTACCGATCTGACCTTTAGC
GAGGATGTGGCTAAGCGCTACGAAGCGTATGGCTGGCAGGTGCTGCGCGG
TTCTATGTATTCGTATACGGATATTATGGATCTCACTGCGTGTGCAAAGC
GTGACGATCGGCCTTCTCTCATTATCCTGCGTTCGATTATTGGAAAGGGT
GCGCCTACCGTTGAAGGGAGCGCGCGTGCCCACGGCGCCCCGCTTGGGGA
AGCGGGGGTGAGAGAGGCAAAAAAGGCATTGGGACTTGATCCTGCGTGCT
CTTTTTTTGTAGCGCCTGAGCTTACCGCTGTTCTCCAGAAACGAAAGTGT
GAATGTGCGCATGTCGAGGACTCGTGGAATGAGCTCTTTGAAGCATGGAG
CACGCAGTATCCTGAAAAACGTGCTGACTGGGACGCTGCTTTTGTTCCCG
GAGGGGTAAGTACTTCGCAGCTAGCTCGTGTTGTCTGTCCCCATTTTGAG
AAGGGTTCGTCACTTGCTACTCGGACTGCTTCTGGAAAGGTGCTCGACGC
GCTCTGCTCTGTGCTACCGAATCTGGTAGGTGGCTCTGCAGATTTACGCG
GGCCGAATGCGGTAGCGGTCTCTTCGTTAAGACCATTTTCTGCAGAGCAT
CGTGCAGGCGGCTACTGTTATTTTGGTGTGCGCGAGTTTGCCATGGCAGC
CATTGTGAACGGAATGCAGTTGCACGGCGGTTTGCGTGCGTTTGGCGCTA
CGTTTATGGTTTTTTCAGACTACTTTCGCCCTGCGCTCCGTCTTGCGGCG
CTCATGCGCATCCCTTCTGTTTTCGTTTTAACACATGACTCTATTTTTGT
AGGAGAAGATGGGCCGACGCACCAACCGGTGGAGACGCTCGCTGCGCTGC
GTGCGATTCCCAACGTGCTTGTTCTGCGCCCTGCTGACGCAGAAGAAACG
TTTGAAGCTTGGAAAATAGCGTTGCTGCACCGCAGTGGTCCTGTGTGTAT
CGTTTTGAGTCGGCAGAACGTGCCGGTTTTTGAGAAAAGTGACAGTTCGT
GGCGCTCTACGGTGGAGGAGTCGGGGGCCTATGTAGTGCGCGAAGGGGGT
GCTACGCCTGAGCTGACTGTCTTGGCAAGTGGCTCTGAGGTGGATTTGGC
GTTGCGTGCCGCGCAGCTGAGTAAAAGACGTGTGCGTGTGGTGTCTGTAC
TGTGCAAGGAGCGTTTTGAGGCAGCAGGGGACGAGGTGCAGCGGCGCATA
CAGGGAGGAGCACGCGTTGTAGTGGCTGAGGCAGGGGTGTATCAAGGCTG
GGGAGCGTGGGCAAAGCGGGAAAAATGCCTTGTGCTCGACCGTTTCGGAR
AGTCAGGCCCTGGTACGCAGGTGGCACAGGCGCTGGAATTTACCGCCGAA
GCGCTGGTGGAAATAATCCTTGATTGGTTAGCA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy