Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap tRNA-Cys-1 IGR397 IGR403 IGR399 IGR405 IGR404 IGR400 IGR402 IGR401 IGR398 TP0552 asnA, - TP0556 phoN, - TP0551 TP0555 tktA, - TP0560 gph, - TP0554 TP0557 TP0558 TP0559 TP0553 TP0552 asnA, - TP0556 phoN, - TP0551 TP0555 tktA, - TP0560 gph, - TP0554 TP0557 TP0558 TP0559 TP0553 Type: tandem, Name:  - 257 Type: tandem, Name:  - 122 Type: tandem, Name:  - 123 Type: tandem, Name:  - 256 asnA, - TP0556 phoN, - TP0551 TP0555 tktA, - TP0560 TP0552 gph, - TP0554 TP0557 TP0558 TP0559 TP0553
* Calculated from Protein Sequence

Gene ID: TP0556

DNA Molecule Name:
1  

Genbank ID:
3322850

Gene Name:
asnA  

Definition:
asparagine synthetase A (aspartate--ammonia ligase)

Gene Start:
603318

Gene Stop:
602329

Gene Length:
990

Molecular Weight*:
36843

pI*:
5.85

Net Charge*:
-6.71

EC:
6.3.1.1  

Functional Class:
Amino acid biosynthesis; Aspartate family  

Pathway: pathway table
Miscellaneous Enzymes

Comment:
Reaction:
ATP + L-ASPARTATE + NH(3) = AMP + PYROPHOSPHATE + L-ASPARAGINE.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed five hits to asparagine synthetase A. For
example residues 1-330 are 72% similar to ASNA_HAEIN, asparagine
synthetase A of Haemophilus influenzae,(U32738).

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 6-325 are 72% similar to asparagine synthetase of ASNA_HAEIN.
Resdiues 269-313 also support this match.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 3 to 246 (E-value = 7.3e-187) place TP0556 in the AsnA family which is described as Aspartate-ammonia ligase (PF03590)

PDB Hit:
none

Gene Protein Sequence:
MEKSFILQQQGISFAKHTFTQKLMEHLGLIEVQGPLLSQVGDGIQDGLSG
REKAVSVSVKQIPGTAFEVVHSLAKWKRHTLARYGFQDNEGLFVHMIALR
PDEDFLDQVRSVCVDQWDWEKVVPVGSRNLAYLKDTVRKVYGALRESEVL
VSERFGLRAFLPADIVFVQSEELVRRYPHLDSKGREDAICKEHGAVFLIG
IGGVLSDGKPHDVRAPDYDDWTTPSEGEYKGLNGDILVWNPVLGRAFEVS
SMGIRVDEGALRTQLALTGDEDSLACSWHQDLINGRLPQSIGGGIGQSRL
AMLLLQRKHIGEVQASVWPRSVREEFENIL

Gene Nucleotide Sequence:  Sequence Viewer
ATGGAAAAATCATTTATTTTGCAACAGCAGGGGATCAGCTTTGCCAAGCA
CACATTTACCCAAAAGCTGATGGAGCACCTGGGACTCATAGAAGTTCAGG
GACCTCTTCTGAGCCAGGTGGGTGACGGGATCCAAGATGGTCTTTCAGGT
CGGGAGAAGGCGGTTTCCGTCTCCGTGAAGCAGATCCCGGGTACTGCCTT
TGAGGTTGTGCACTCGTTAGCAAAGTGGAAGCGCCACACGCTTGCCCGCT
ACGGCTTTCAGGATAATGAGGGTTTGTTTGTACACATGATCGCGCTCCGC
CCGGATGAAGATTTCTTGGATCAGGTGCGCTCTGTGTGTGTGGATCAGTG
GGATTGGGAGAAGGTAGTACCGGTAGGGTCGAGAAATCTTGCGTATCTGA
AGGACACGGTGCGTAAGGTCTACGGTGCTCTTCGGGAGTCGGAGGTGTTG
GTAAGTGAGAGGTTCGGCCTACGGGCGTTTTTGCCTGCGGATATTGTATT
TGTACAGAGCGAGGAGCTGGTGCGGCGTTATCCGCATTTAGACAGCAAGG
GGCGTGAGGATGCTATTTGCAAAGAGCATGGTGCGGTGTTCCTGATTGGG
ATCGGTGGTGTGCTTTCTGACGGCAAGCCGCACGATGTGCGCGCTCCAGA
TTACGATGACTGGACGACGCCTTCCGAAGGGGAATACAAGGGCCTGAACG
GCGATATTTTGGTGTGGAATCCAGTGTTGGGGCGTGCGTTTGAAGTGTCT
TCGATGGGGATACGGGTGGACGAGGGTGCGCTTCGCACGCAGCTGGCTCT
TACTGGCGATGAGGATAGTCTGGCATGCAGCTGGCACCAGGATCTGATCA
ATGGTCGTCTTCCTCAATCCATCGGAGGTGGTATCGGTCAATCCCGTTTG
GCGATGCTACTCCTACAAAGGAAGCATATTGGTGAAGTTCAGGCCAGTGT
ATGGCCGCGGTCGGTGAGGGAGGAGTTCGAGAACATTCTT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy