Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap tRNA-Cys-1 IGR396 IGR397 IGR403 IGR399 IGR395 IGR404 IGR400 IGR402 IGR401 IGR398 TP0552 asnA, - TP0556 phoN, - TP0551 TP0555 thdF, - TP0550 gph, - TP0554 TP0557 TP0558 TP0559 TP0553 clpC, - TP0549 TP0552 asnA, - TP0556 phoN, - TP0551 TP0555 thdF, - TP0550 gph, - TP0554 TP0557 TP0558 TP0559 TP0553 clpC, - TP0549 Type: tandem, Name:  - 257 Type: tandem, Name:  - 122 Type: tandem, Name:  - 123 Type: tandem, Name:  - 256 TP0552 asnA, - TP0556 phoN, - TP0551 TP0555 thdF, - TP0550 gph, - TP0554 TP0557 TP0559 TP0553 clpC, - TP0549 TP0558
* Calculated from Protein Sequence

Gene ID: TP0554

DNA Molecule Name:
1  

Genbank ID:
3322848

Gene Name:
gph  

Definition:
phosphoglycolate phosphatase

Gene Start:
600181

Gene Stop:
600846

Gene Length:
666

Molecular Weight*:
24562

pI*:
6.25

Net Charge*:
-2.70

EC:
3.1.3.18  

Functional Class:
Energy metabolism; Sugars  

Pathway: pathway table
Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism

Comment:
Reaction:
2-PHOSPHOGLYCOLATE + H(2)O = GLYCOLATE + ORTHOPHOSPHATE.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to phosphoglycolate
phosphatases. For example residues 6-217 are 26% similar to
phosphoglycolate phosphatase (gph) of Borrelia burgdorferi,(AE001168).

COGS Summary:  COGS Search
BeTs to 11 clades of COG0546
COG name: Predicted phosphatases
Functional Class:  R
The phylogenetic pattern of COG0546 is a-TkyQ-CEBRhuj--oL---
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
Residues 5-16, 104-117, 135-151, and 153-173 represent significant (99%)
hits to blocks PR00413A,D,E,F, HALOACID DEHALOGENASE/EPOXIDE HYDROLASE
FAMILY SIGNATURE.

ProDom Summary:  Protein Domain Search
Residues 148-184 are 48% similar to a region of YTRE_PSESS, a hypothetical
protein with similarity in that region to phosphoglycolate phosphatases.

Paralogs:  Local Blast Search
This protein is paralogously related to TP0407, phosphoglycolate
phosphatase. Residues 94-187 are 32% similar to TP0407.

Pfam Summary:  Pfam Search
Residues 5 to 194 (E-value = 1.1e-34) place TP0554 in the Hydrolase family which is described as haloacid dehalogenase-like hydrolase (PF00702)

PDB Hit:
none

Gene Protein Sequence:
MRPMTRACIFDLDGTLTNTLGTIAYFVNMQAAHYHLPPIPSEKFALFLGD
GSRALIQRVLAHYGAAAQTISEDEFLQRYCLAYEADFLQRCTVYPGVPEM
LVELKRRRIELAILSNKPHSIAQKVASAFFGDNVFSVVLGQREGVPVKPD
PAGLFEILRTLNVETAEALFVGDTAVDIRTASAAQVRSVGVLWGFRDETE
LSQAQAHVLIRTPAELLQHLSF

Gene Nucleotide Sequence:  Sequence Viewer
ATGCGGCCCATGACGCGCGCGTGTATATTCGATCTTGATGGAACGCTAAC
GAATACGCTGGGGACCATTGCCTACTTCGTCAATATGCAGGCTGCCCATT
ACCATTTACCCCCAATTCCCTCTGAAAAGTTTGCGCTGTTTTTAGGAGAT
GGTTCGCGCGCACTGATTCAGCGCGTGCTTGCTCATTACGGCGCTGCAGC
TCAGACTATTTCTGAGGATGAATTTTTACAGCGCTACTGCCTCGCGTATG
AGGCAGACTTTCTCCAACGCTGTACTGTATATCCGGGGGTTCCTGAGATG
CTTGTGGAGTTGAAACGACGCCGCATAGAACTCGCCATTCTCTCCAACAA
GCCACATTCTATCGCGCAGAAGGTAGCGTCTGCTTTTTTTGGGGACAATG
TTTTCTCAGTGGTGCTTGGCCAACGCGAAGGCGTACCCGTAAAACCAGAT
CCTGCTGGGCTTTTTGAGATCCTGCGTACCCTAAACGTGGAGACGGCGGA
GGCGCTTTTCGTCGGAGACACCGCCGTGGATATACGCACCGCGTCCGCAG
CGCAAGTGCGCAGCGTGGGAGTGCTCTGGGGCTTTCGAGACGAGACGGAG
CTATCCCAGGCGCAAGCCCACGTGCTTATCAGGACGCCCGCCGAGTTACT
CCAGCACCTTTCTTTC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy