Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap tRNA-Cys-1 IGR396 IGR397 IGR395 IGR394 IGR393 IGR398 TP0552 phoN, - TP0551 thdF, - TP0550 htrA, - TP0546 TP0553 TP0548 clpC, - TP0549 TP0552 phoN, - TP0551 thdF, - TP0550 htrA, - TP0546 TP0553 TP0548 clpC, - TP0549 Type: tandem, Name:  - 256 Type: tandem, Name:  - 122 Type: tandem, Name:  - 254 Type: tandem, Name:  - 255 TP0552 phoN, - TP0551 thdF, - TP0550 htrA, - TP0546 lytB, - TP0547 lytB, - TP0547 TP0553 TP0548 clpC, - TP0549
* Calculated from Protein Sequence

Gene ID: TP0549

DNA Molecule Name:
1  

Genbank ID:
3322841

Gene Name:
clpC  

Definition:
ATP-dependent Clp protease

Gene Start:
593081

Gene Stop:
595522

Gene Length:
2442

Molecular Weight*:
91576

pI*:
7.73

Net Charge*:
6.17

EC:
3.4.21.-  

Functional Class:
Translation; Degradation of proteins, peptides, and glycopeptides  

Pathway: pathway table
Miscellaneous Enzymes

Comment:
See TP0801 (clpA), TP0507 (clpP), TP0508 (clpX)
TP1041 (clpP), TP0071 (clpB).

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to ClpC ATPase and to
one hemolysin. For example residues 1-791 are 45% similar to
ATP-dependent Clp protease of Aquifex aeolicus,(AE000733). Residues
5-808 are 43% similar to hemolysin of Serpulina hyodysenteriae,
(X73140).

COGS Summary:  COGS Search
BeTs to 14 clades of COG0542
COG name: ATPases with chaperone activity, ATP-binding domain
Functional Class:  O
The phylogenetic pattern of COG0542 is --t-YQVCEBRhUJgpOLINx
Number of proteins in this genome belonging to this COG is 3

Blocks Summary:  Blocks Search
Residues 177-222, 511-556, 229-268, 274-288, 292-334, 362-404, 503-551,
566-614, 629-657, 694-708, and 752-764 represent significant (100%)
hits to blocks BL00870A,B,C,D,E,F,G,H,I,J, CLPAB_1;Chaperonins clpA/B
proteins. Residues 394-408, 537-552, 203-218, and 263-282 represent
significant (99%) hits to blocks PR00819A,B,D, CBXX/CFQX SUPERFAMILY
SIGNATURE. Residues 535-556, 201-222, and 252-288 represent significant
(98%) hits to blocks BL00674B,C,

ProDom Summary:  Protein Domain Search
Residues 163-405 are 58% similar to ATP-dependent Clp protease of
MECB_BACSU. Residues 413-503, 593-625, 638-658 and 685-786 also
support matches to ATP-dependent Clp protease.

Paralogs:  Local Blast Search
This protein is paralogously related to TP0071, TP0801, and
TP0508 all of which are ATP-dependent Clp protease subunits.
Residues 29-792 are 38% similar to TP0071 and residues 147-789 are
41% similar to TP0801. Residues 539-768 are 23% similar and residues
138-281 are 27% similar to TP0508.

Pfam Summary:  Pfam Search
Residues 17 to 69 (E-value = 4.4e-06) place TP0549 in the Clp_N family which is described as Clp amino terminal domain (PF02861)
Residues 94 to 146 (E-value = 9e-08) place TP0549 in the Clp_N family which is described as Clp amino terminal domain (PF02861)
Residues 203 to 404 (E-value = 5.8e-13) place TP0549 in the AAA family which is described as ATPase family associated with various cellular activities (AAA) (PF00004)
Residues 537 to 750 (E-value = 9.1e-05) place TP0549 in the AAA family which is described as ATPase family associated with various cellular activities (AAA) (PF00004)

PDB Hit:
none

Gene Protein Sequence:
MLQDLSANARKVLLELGQTVAREARASLLQPEHILLALIQHKVGRGYKLI
EKLIEDVATVRLILEQHVLTNEGDVASPQDLPVSGRVKHLLDIAAMEARS
LRCAYIGTEHLVIAFAREEQNPLFQSLIREGLSLDDLRNASIISSPHSDT
TRTRLERKVASVLDEYGTDLTERARAGALNPVIGRNKEITRVIQILCRRG
KNNPVLIGEPGVGKTSIVEGLAYAIVREEVPHILLHTRVVSLDLAAVIAG
TKYRGQFEERLKRIIKEVEETEKVILFIDELHTLIGAGGTQGSLDAANML
KPALARGQIQCIGATTLAEYRRYFEKDAALTRRFRSVLVREPSFEETCTI
LRKIKSHYERHHQVIYQSDALEKIVELSRRYIPERFFPDKAIDLMDEVGA
MKRVQQRADTQVLRSFSIKVANLTTETERAIALEDWARARSLHTDVVQLR
RRLHALKVEWSAREALSIFAEDVAQAVSLMTDIPVHSLEGDELCRFTNIE
RDLCATVRGQREAIATLARAIVRARVGISSDTRPIGSFLFLGPTGVGKTL
LAKTLAEFLFGSADALIRIDMSDYMERYNTSRLMGAPPGYVGFENGGLLT
ERVRHRPFSVILLDEIEKAHPDVFNVLLQVLEEGELQDNLGHTVNFRNTI
IIMTSNAGTRGLGENVPGFQTARARNIEYRQLRVQALREIKRIFSPEFLN
RVDECVVFAPLERETLQEILECELKKLAERLRGKDIVLRYSAAAKAYCLE
HGFDPFLGARPLRRVLQQEIENELALRMIHGTLRAGSCVHIDSDGARLHL
STEKSYLTLHPQEI

Gene Nucleotide Sequence:  Sequence Viewer
GTGTTACAGGACCTATCCGCAAATGCCCGTAAGGTACTGCTCGAGCTCGG
TCAGACCGTTGCGCGTGAGGCTCGCGCCTCGCTCCTTCAGCCAGAGCACA
TTCTGCTCGCCCTCATTCAGCACAAAGTAGGCCGCGGCTACAAGCTCATC
GAAAAACTCATTGAAGATGTCGCTACCGTCCGCCTCATCCTCGAGCAACA
CGTCCTTACCAATGAGGGAGACGTCGCCAGTCCCCAGGACCTGCCCGTCT
CAGGACGCGTCAAACACTTGCTCGACATCGCAGCAATGGAAGCACGCTCC
CTGCGGTGCGCTTACATCGGTACCGAACACCTCGTTATCGCCTTTGCCCG
AGAGGAGCAAAATCCTCTCTTCCAAAGCCTCATCCGAGAAGGACTCTCGC
TCGATGACCTGCGAAACGCGAGCATTATATCCTCACCTCATTCTGATACC
ACCCGCACCCGGCTCGAGCGGAAAGTTGCAAGTGTCCTTGACGAATACGG
CACCGACCTTACCGAACGCGCGCGCGCCGGCGCCCTCAATCCGGTCATCG
GACGAAACAAAGAAATTACCCGCGTCATTCAAATCCTGTGCCGGAGAGGA
AAAAATAACCCGGTGCTCATCGGAGAGCCAGGTGTCGGGAAAACTTCCAT
CGTTGAGGGGCTCGCGTACGCCATCGTTCGGGAGGAGGTCCCGCACATCC
TGCTGCACACCCGCGTCGTTTCCCTAGACCTTGCCGCCGTCATAGCAGGA
ACAAAGTACCGCGGCCAGTTTGAGGAGCGGCTCAAACGCATTATTAAGGA
GGTGGAAGAAACTGAAAAAGTCATCCTTTTCATCGATGAGCTGCACACAC
TCATCGGAGCAGGAGGCACGCAGGGGTCTTTGGACGCCGCCAACATGCTC
AAGCCGGCCCTTGCACGCGGACAAATCCAGTGCATTGGGGCAACAACCCT
GGCAGAGTATCGCCGTTACTTTGAAAAAGACGCAGCTCTCACCCGCCGAT
TCCGATCGGTGCTCGTGCGTGAACCGAGCTTTGAAGAAACCTGCACTATT
TTACGCAAAATAAAATCACACTACGAACGACATCACCAGGTGATATACCA
AAGCGATGCGCTTGAAAAAATTGTTGAGCTTTCACGGCGCTACATCCCTG
AGCGGTTCTTTCCAGATAAGGCAATTGATCTTATGGATGAAGTAGGAGCC
ATGAAACGGGTACAACAGCGCGCGGATACGCAGGTATTGCGTTCCTTTTC
CATAAAAGTTGCTAATCTTACCACAGAGACTGAGCGCGCCATTGCGCTTG
AAGATTGGGCGCGCGCGCGTTCCTTACACACCGATGTGGTGCAGCTGCGC
AGACGGCTCCACGCGCTGAAGGTAGAGTGGAGCGCGCGCGAAGCGCTGTC
TATCTTTGCAGAAGATGTTGCACAGGCTGTCTCTCTCATGACCGATATCC
CGGTACATTCGCTCGAAGGGGATGAGCTGTGCCGCTTTACCAATATCGAA
CGGGATCTTTGTGCCACCGTGCGTGGGCAGCGCGAGGCCATTGCAACGCT
CGCGCGCGCTATCGTACGCGCGCGTGTCGGCATCTCTTCAGACACGCGCC
CCATTGGCTCCTTCCTGTTTCTTGGACCGACCGGTGTAGGCAAAACGCTC
TTGGCAAAGACACTCGCGGAATTTCTTTTCGGTTCAGCAGACGCGCTCAT
CCGCATTGACATGAGCGACTACATGGAACGCTACAACACCTCACGCCTCA
TGGGAGCACCGCCTGGATACGTGGGATTTGAAAATGGCGGTCTACTTACC
GAGCGCGTACGGCACCGCCCTTTTTCTGTCATCCTTCTGGATGAAATTGA
AAAGGCGCATCCAGATGTCTTCAATGTTCTCCTCCAGGTGTTAGAAGAAG
GAGAGCTGCAAGACAACCTGGGGCACACGGTGAACTTCCGCAACACTATC
ATCATCATGACCAGCAATGCAGGCACACGCGGCCTGGGGGAAAACGTTCC
TGGCTTTCAAACCGCACGCGCGCGAAACATCGAGTACCGTCAGCTGCGCG
TACAGGCCCTCCGGGAAATAAAACGCATCTTCTCTCCGGAGTTTCTCAAT
CGCGTTGACGAGTGCGTAGTGTTTGCTCCGCTTGAGCGAGAGACCCTGCA
GGAAATTTTAGAATGCGAACTGAAGAAGCTCGCAGAACGCCTACGCGGTA
AAGATATTGTGCTGCGCTACAGCGCGGCTGCAAAGGCCTACTGTCTTGAA
CACGGCTTTGACCCATTCTTGGGCGCACGCCCCCTGCGCCGCGTATTGCA
GCAAGAAATTGAAAATGAGCTTGCGCTGCGCATGATTCACGGAACGTTGC
GCGCAGGATCGTGCGTGCACATAGACTCAGACGGCGCGCGCCTCCACCTT
TCTACCGAAAAAAGTTACCTGACGCTGCATCCCCAAGAAATA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy