Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR391 IGR390 IGR389 IGR392 IGR394 IGR393 ruvA, - TP0543 mglB, - TP0545 pfpB, - TP0542 TP0544 htrA, - TP0546 TP0548 clpC, - TP0549 ruvA, - TP0543 mglB, - TP0545 pfpB, - TP0542 TP0544 htrA, - TP0546 TP0548 clpC, - TP0549 Type: tandem, Name:  - 254 Type: tandem, Name:  - 255 mglB, - TP0545 pfpB, - TP0542 TP0544 htrA, - TP0546 lytB, - TP0547 lytB, - TP0547 ruvA, - TP0543 TP0548 clpC, - TP0549
* Calculated from Protein Sequence

Gene ID: TP0546

DNA Molecule Name:
1  

Genbank ID:
3322839

Gene Name:
htrA  

Definition:
periplasmic serine protease DO

Gene Start:
590693

Gene Stop:
588696

Gene Length:
1998

Molecular Weight*:
73312

pI*:
9.88

Net Charge*:
31.31

EC:
3.4.21.-  

Functional Class:
Translation; Degradation of proteins, peptides, and glycopeptides  

Pathway: pathway table
Miscellaneous Enzymes

Secondary Evidence:
Kim DY, Kim DR, Ha SC, Lokanath NK, Lee CJ, Hwang HY, Kim KK.
Crystal structure of the protease domain of a heat-shock protein HtrA from Thermotoga maritima.
J Biol Chem. 2003 Feb;278(8):6543-51.
PMID: 12458220

Silva P, Choi YJ, Hassan HA, Nixon PJ.
Involvement of the HtrA family of proteases in the protection of the cyanobacterium Synechocystis PCC 6803 from light stress and in the repair of photosystem II.
Philos Trans R Soc Lond B Biol Sci. 2002 Oct;357(1426):1461-7; discussion 1467-70.
PMID: 12437885

Clausen T, Southan C, Ehrmann M.
The HtrA family of proteases: implications for protein composition and cell fate.
Mol Cell. 2002 Sep;10(3):443-55.
PMID: 12408815

Kim KI, Park SC, Kang SH, Cheong GW, Chung CH.
Selective degradation of unfolded proteins by the self-compartmentalizing HtrA protease, a periplasmic heat shock protein in Escherichia coli.
J Mol Biol. 1999 Dec;294(5):1363-74.
PMID: 10600391

Comment:
This protein is a serine protease that is required at high temperature.
It is involved in the degradation of damaged proteins. It can degrade
IciA, Ada, casein and globin.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed the middle region had several significant hits
to periplasmic serine proteases. For example residues 238-622 are
31% similar to periplasmic serine protease of Aquifex aeolicus, (AE000741).

COGS Summary:  COGS Search
BeTs to 13 clades of COG0265
COG name: Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain
Functional Class:? O
The phylogenetic pattern of COG0265 is --t-yqvCEBRHuj--oLinX
Number of proteins in this genome belonging to this COG is 3

Blocks Summary:  Blocks Search
Residues 296-308, 327-347, 367-391, 400-417, and 500-512 represent
significant (100%) hits to blocks PR00834A,B,C,D,F, HTRA/DEGQ PROTEASE
FAMILY SIGNATURE. Residues 209-223 represent a significant (99%) hit
to blocks PR00702I, ACRIFLAVIN RESISTANCE PROTEIN FAMILY SIGNATURE.
Residues 41-60 represent a significant (98%) hit to block PR00658A,
CD44 ANTIGEN PRECURSOR SIGNATURE. Residues 370-378 represent a
significant (95%) hit to block PR00410F, PHENOL HYDROXYLASE REDUCTASE
FAMILY SIGNATURE.

ProDom Summary:  Protein Domain Search
Residues 296-468 are 39% similar to periplasmic serine protease of
HTRA_BARHE.

Paralogs:  Local Blast Search
This protein is paralogously related to TP0773 and TP0841, both
of which are periplasmic serine protease DO (htrA). Residues 287-542
are 35% similar to TP0773 and residues 279-518 are 31% similar to
TP0841.

Pfam Summary:  Pfam Search
Residues 269 to 453 (E-value = 2.5e-09) place TP0546 in the Trypsin family which is described as Trypsin (PF00089)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
214

PDB Hit:
none

Gene Protein Sequence:
MAGRACRRYSPRYLCLQCGGHQCRGFHPRLCYRCCGAGAAHGRRACRFSG
VFLCSAQGEYLQGCLCGGYFFRRFSGCIRRGVARCCPTFCCRLRAVKTAS
LCLRSAWLNVALGGVLGVLSGCRVFDERADVRVDRTGKEYLDAQVACAKE
ELRARPLRALMCAIALKRNAPAHQKVAQLYAQALARVKEAFRYSVEKQKW
SEALVFFRSLSALRIPLKDWTERSLHRAQIEQWKKEGAHVLVAAQEKRAG
TSAARSPAAMIKGTVTILVDRGIRVEHGRGFADRVIGSGFFIDKRGYIVT
NYHVIRSEVDPAYEGYSRAYIKLPSDNTVKVPVRVVGWDALADLALLKTE
ITPEVVFGLGSSKNLDVGSKIYAIGSPAGLERTLTSGIVSAKKRKLLSVG
GGVLQIDASINRGNSGGPVIDEEGCVQAVAFAGVEQHAGLNFAIPVELLK
QVLPSLYRGGLVTHPWLGAFGETHRVWKNAGVGGVLSSYVIPGSPLSYAG
IPEGAIITTVNDASVSCVADLQAELEKYVPETIVRLAGYRLRDKSKLHDL
AAYEQDEWYCQLGVRPEHPARILYKYDLSYRAFLPLFGMRLARTGTRNTY
RVESLVPGNFADEHGFSTYDVIEIQNIYMIEASEAIVADVYAKRRKAGYI
DTFMRLVAALDNPSFF

Gene Nucleotide Sequence:  Sequence Viewer
GTGGCTGGTAGAGCGTGTAGAAGATATTCCCCCCGATATCTATGCCTTCA
GTGCGGTGGGCATCAGTGCAGGGGCTTCCACCCCAGACTGTGTTATCGCT
GCTGTGGAGCAGGCGCTGCGCACGGGCGGCGCGCCTGTCGCTTCTCGGGT
GTCTTCCTCTGCTCTGCCCAAGGTGAGTACCTGCAGGGCTGTTTGTGCGG
CGGCTACTTCTTCCGTCGGTTCAGCGGGTGCATCCGGCGCGGTGTCGCCC
GGTGCTGTCCGACCTTTTGCTGTAGGCTCCGTGCGGTGAAAACCGCTTCC
CTTTGTCTGCGAAGTGCATGGCTGAACGTTGCGCTCGGCGGGGTGCTGGG
TGTCCTTTCCGGTTGTCGTGTCTTCGACGAAAGGGCGGATGTGCGCGTCG
ACCGTACGGGAAAAGAATACCTCGATGCACAGGTTGCGTGTGCAAAAGAG
GAGCTGCGCGCGCGTCCTCTGCGGGCGCTTATGTGTGCAATTGCGCTCAA
AAGAAATGCCCCAGCACATCAGAAGGTGGCTCAGCTGTATGCCCAGGCGC
TTGCGCGCGTCAAAGAGGCGTTTCGCTATTCAGTGGAGAAACAGAAGTGG
TCGGAGGCACTTGTGTTTTTTCGTTCCCTCTCGGCACTTCGCATTCCGCT
GAAGGACTGGACGGAGCGATCGCTGCATCGTGCGCAAATTGAACAGTGGA
AAAAGGAGGGTGCGCACGTATTGGTTGCGGCGCAAGAGAAGCGCGCCGGA
ACTTCTGCTGCGCGGAGTCCGGCAGCCATGATAAAGGGGACGGTCACCAT
TTTGGTAGATCGAGGAATTCGCGTAGAGCACGGACGCGGGTTTGCAGATC
GAGTTATCGGGTCAGGTTTTTTCATCGACAAGAGGGGCTATATCGTCACT
AACTACCACGTTATCAGAAGCGAGGTAGATCCTGCGTACGAAGGGTATTC
GCGTGCGTACATCAAGCTCCCCTCAGACAACACCGTGAAAGTTCCGGTGC
GCGTTGTCGGGTGGGATGCGCTTGCAGATCTTGCATTGCTAAAAACAGAA
ATTACTCCTGAGGTGGTGTTTGGCTTAGGTTCCTCAAAGAATTTGGACGT
GGGGAGTAAAATCTACGCGATAGGATCGCCTGCTGGGCTTGAACGAACGC
TTACTTCTGGCATCGTGTCTGCGAAAAAGCGCAAACTGCTTTCAGTCGGT
GGGGGAGTGCTGCAGATAGACGCATCCATTAATCGAGGGAACTCAGGCGG
TCCAGTTATCGACGAGGAAGGGTGCGTTCAGGCAGTAGCGTTTGCAGGTG
TGGAGCAGCATGCAGGGCTTAATTTTGCCATTCCTGTAGAATTGCTCAAG
CAGGTGCTGCCAAGCTTGTACCGCGGGGGATTGGTGACGCATCCGTGGCT
TGGTGCGTTTGGTGAAACACACCGTGTGTGGAAAAATGCTGGCGTCGGCG
GTGTGCTTTCTTCGTACGTTATTCCTGGCAGTCCTCTCTCGTACGCAGGA
ATACCAGAAGGGGCAATTATTACCACGGTCAATGATGCATCCGTTTCTTG
TGTAGCTGACTTACAGGCAGAGTTGGAAAAATACGTGCCCGAAACTATCG
TCCGTCTTGCAGGGTACCGACTGCGGGACAAGAGCAAACTGCATGATCTG
GCCGCCTATGAGCAGGATGAATGGTACTGCCAGTTAGGAGTACGGCCGGA
ACATCCTGCCCGGATCCTGTATAAGTACGACTTATCGTACCGGGCCTTCT
TGCCCCTTTTTGGGATGCGCTTGGCGCGCACCGGCACGCGCAACACCTAC
CGTGTGGAGTCACTGGTTCCTGGCAATTTTGCAGATGAGCATGGCTTTAG
CACGTACGACGTAATAGAAATCCAAAACATATACATGATTGAGGCAAGTG
AGGCGATTGTCGCAGACGTGTACGCTAAACGGCGCAAGGCCGGGTACATA
GACACGTTCATGCGATTGGTGGCAGCACTGGATAATCCATCCTTTTTC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy