Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR388 IGR391 IGR390 IGR389 IGR392 IGR394 IGR393 ruvA, - TP0543 mglB, - TP0545 pfpB, - TP0542 TP0544 htrA, - TP0546 era, - TP0541 TP0548 ruvA, - TP0543 mglB, - TP0545 pfpB, - TP0542 TP0544 htrA, - TP0546 era, - TP0541 TP0548 ruvA, - TP0543 mglB, - TP0545 pfpB, - TP0542 TP0544 htrA, - TP0546 lytB, - TP0547 lytB, - TP0547 era, - TP0541 TP0548
* Calculated from Protein Sequence

Gene ID: TP0545

DNA Molecule Name:
1  

Genbank ID:
3322834

Gene Name:
mglB  

Definition:
D-galactose/ D-glucose binding protein

Gene Start:
588608

Gene Stop:
587547

Gene Length:
1062

Molecular Weight*:
38352

pI*:
8.76

Net Charge*:
8.08

EC:
 

Functional Class:
Transport and binding proteins; Carbohydrates, organic alcohols, and acids  

Pathway: pathway table
Signal transduction; Bacterial chemotaxis

Primary Evidence:
Porcella SF, Popova TG, Hagman KE, Penn CW, Radolf JD, Norgard MV. 1996. A mgl-like operon in Treponema pallidum, the
syphilis spirochete. Gene Oct 24;177(1-2):115-21. Medline: 97080510.

Becker PS, Akins DR, Radolf JD, Norgard MV. 1994. Similarity between the 38-kilodalton lipoprotein of Treponema pallidum and the glucose/galactose-binding (MglB) protein of Escherichia coli. Infect Immun Apr;62(4):1381-91. Medline: 94178946.

Secondary Evidence:
Stamm LV, Young NR, Frye JG, Hardham JM. 1996. Identification and sequences of the Treponema pallidum mglA and mglC genes. DNA Seq;6(5):293-8. Medline: 97142131.

Comment:
This protein is involved in the active transport of galactose and
glucose. It plays a role in the chemotaxis towards the two
sugars by interacting with the Trg chemoreceptor.

Please go to...
http://www.stdgen.lanl.gov

ABC transporters

Treponema pallidum

Data table
NBD Amino Acid Alignment
NBD Organization
Plasma membrane Organization

for a complete listing of Treponema pallidum ABC transporters,
alignments of transporters, nucleotide binding domain organization,and plasma membrane organization.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to D-Glucose and
D-galactose binding proteins. For example residues 28-345 are 36%
similar to DGAL_SALTY, D-galactose/ D-glucose binding protein of
Salmonella typhimurium.

COGS Summary:  COGS Search
BeTs to 4 clades of COG1879
COG name: Periplasmic sugar-binding proteins
Functional Class:  G
The phylogenetic pattern of COG1879 is ------V-Eb-H-----l---
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 63-112 are 58% similar to D-GALACTOSE-BINDING PERIPLASMIC
PROTEIN PRECURSOR of DGAL_CITFR. Residues 120-187 and 227-281
also support this match.

Paralogs:  Local Blast Search
This protein is paralogously related to TP0684, methylgalactoside
ABC transporter, periplasmic galactose-binding protein (mglB).
Residues 107-300 are 36% similar to TP0684.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
gram positive/gram negative signal  
1  
19

PDB Hit:
gi|230520|pdb|2GBP| D-GalactoseD-Glucose Binding Protein (GGBP)

Gene Protein Sequence:
MKGTGMCVALLLCALGAGACKRSEKPTIGVVVYQYDNTLVARLRHILSTV
GKKHARILIVDSQASQSIQNKHIDQFIARGVHGLAVNLVDHRAARTVIEK
AQQARIPLVFFNRMPDLSDLNRYARAYYVGVKDDELGLLQSRLVAQYLER
TPSADKNADGIIQCVVLKGDPDHKSGARCARYVCQALREIGLKGEIIGEA
FALDSRVKGQAAMHTLIHTHGDRIEAVFANNDDAALGAIEALQSAGFFKE
NKRVPVVGIDATASALKAIEEDLMLGTVLNDVSSQGKAILNLLFALMGDS
VPSIPAEDSTAFTHAGNGVAGRAAVFGTAEKQCVWIPYKVVTKENYRTVQ
NYLR

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAGGTACAGGGATGTGTGTAGCGCTCCTTTTGTGTGCACTTGGTGC
GGGCGCGTGCAAGCGCAGCGAAAAGCCGACTATCGGAGTAGTCGTGTATC
AGTATGACAACACGCTCGTGGCGCGCTTGCGTCACATACTCTCTACGGTT
GGCAAAAAACATGCTCGAATCCTCATCGTGGATAGTCAGGCATCGCAGAG
TATTCAGAACAAGCACATCGATCAATTTATTGCGCGCGGCGTGCACGGTC
TTGCGGTAAATCTTGTAGACCATCGTGCTGCGCGCACGGTTATTGAAAAG
GCACAGCAGGCGCGCATTCCGCTAGTATTCTTCAATCGTATGCCTGACCT
TTCTGATTTGAACCGGTATGCACGCGCCTATTACGTAGGCGTCAAGGACG
ACGAGCTTGGTTTGCTGCAAAGCAGACTGGTTGCGCAATATCTGGAACGT
ACACCAAGTGCAGATAAGAACGCCGACGGTATTATCCAATGCGTAGTGCT
CAAAGGGGATCCTGATCATAAAAGCGGTGCTCGCTGTGCGCGGTATGTGT
GTCAGGCGCTGAGAGAAATCGGATTAAAGGGCGAGATAATCGGGGAGGCT
TTTGCGCTTGACAGTCGGGTGAAAGGACAGGCTGCGATGCACACGCTTAT
TCACACACACGGAGATCGCATTGAGGCAGTATTTGCGAATAACGATGACG
CAGCGCTCGGCGCCATTGAAGCGTTGCAGAGTGCAGGTTTTTTTAAAGAA
AATAAGCGTGTGCCGGTTGTGGGTATCGATGCTACTGCGTCTGCTTTGAA
AGCTATTGAAGAGGATCTGATGCTCGGCACCGTCCTTAACGATGTCTCCA
GTCAGGGGAAGGCTATTTTAAATCTTTTGTTTGCACTTATGGGTGATTCT
GTCCCATCGATCCCCGCTGAAGACAGCACTGCGTTTACGCACGCAGGAAA
CGGAGTGGCAGGACGCGCGGCAGTATTCGGTACGGCAGAAAAGCAGTGTG
TGTGGATCCCCTATAAAGTTGTCACCAAAGAAAACTACCGTACTGTGCAA
AATTACCTGCGC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy