Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap tRNA-Asn-1 IGR388 IGR391 IGR390 IGR389 IGR392 IGR387 IGR384 IGR385 IGR386 ruvA, - TP0543 tpi, - TP0537 mglB, - TP0545 pgk, - TP0538 pfpB, - TP0542 TP0544 htrA, - TP0546 TP0539 TP0540 era, - TP0541 ruvA, - TP0543 tpi, - TP0537 mglB, - TP0545 pgk, - TP0538 pfpB, - TP0542 TP0544 htrA, - TP0546 TP0539 TP0540 era, - TP0541 ruvA, - TP0543 tpi, - TP0537 mglB, - TP0545 pgk, - TP0538 pfpB, - TP0542 TP0544 htrA, - TP0546 TP0540 era, - TP0541 TP0539
* Calculated from Protein Sequence

Gene ID: TP0542

DNA Molecule Name:
1  

Genbank ID:
3322832

Gene Name:
pfpB  

Definition:
pyrophosphate--fructose 6-phosphate 1-phosphotransferase, beta subunit

Gene Start:
584866

Gene Stop:
583148

Gene Length:
1719

Molecular Weight*:
62418

pI*:
6.74

Net Charge*:
-2.06

EC:
2.7.1.90  

Functional Class:
Energy metabolism; Glycolysis  

Pathway: pathway table
Carbohydrate metabolism; Galactose metabolism
Carbohydrate metabolism; Glycolysis / Gluconeogenesis
Carbohydrate metabolism; Pentose phosphate cycle

Comment:
This enzyme is a tetramer of two alpha chains and two beta chains.

Reaction:
PYROPHOSPHATE + D-FRUCTOSE 6-PHOSPHATE =
ORTHOPHOSPHATE + D-FRUCTOSE 1,6-BISPHOSPHATE.

See TP0108, pfpA.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to pyrophosphate--
fructose 6-phosphate 1-phosphotransferase, beta subunit proteins.
For example residues 1-558 are 50% similar to pyrophosphate--
fructose 6-phosphate 1-phosphotransferase, beta subunit of Borrelia
burgdorferi, (AE001116).

COGS Summary:  COGS Search
BeTs to 11 clades of COG0205
COG name: 6-phosphofructokinase
Functional Class:  G
The phylogenetic pattern of COG0205 is ----YqVCebrh--gpOLIN-
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
Residues 179-220, 160-196, 435-478, 206-249, and 529-561 represent
significant (99%) hits to blocks (BL00433A,C,D,E), Phosphofructokinase
proteins. Residues 20-37 represent significant (95%) but unlikely hits
to bocks (BL01112B), RNA polymerases N / 8 Kd subunits proteins.

ProDom Summary:  Protein Domain Search
Residues 218-558 are 51% similar to PYROPHOSPHATE--FRUCTOSE 6-PHOSPHATE
1-PHOSPHOTRANSFERASE of PFPB_RICCO. Residues 3-66, 81-106, 82-182,
113-166, and 206-321 also support this match.

Paralogs:  Local Blast Search
This protein is paralogously related to TP0108, pyrophosphate--
fructose 6-phosphate 1-phosphotransferase . Residues 78-283 are 28%
similar to TP0108.

Pfam Summary:  Pfam Search
Residues 82 to 373 (E-value = 1.1e-08) place TP0542 in the PFK family which is described as Phosphofructokinase (PF00365)

PDB Hit:
none

Gene Protein Sequence:
MSISLLQQERHRYLPKVPDLLRGDFRRVCARRGLSTTAVADYDALRSLFA
RTYGQPLVNFVNASEKNEDSPMETAPEPRGLRVAIVLSGGQAPGGHNVIA
GLFDGLKRWHADSVLIGFLGGPAGVLSGDHIEICADRVDAYRNTGGFDLI
GSGRTKIESESQFAAAAQTVTRMALDALVVVGGDDSNTNAALLAEHFVNS
GISTKVIGVPKTIDGDLKNEAIETSFGFDTATKTYSELIGNIARDACSAR
KYWHFIKLMGRSASHIALECALKTQPNVCLISEEVAAQSLTLAQIVQSLC
DTIATRAQHGEHFGIVLVPEGLIEFIPEMKALITELNEVMARRAQEFEAL
DTPDAQRVWIEQALSASARAVFNALPAEISTQLLADRDPHGNVQVSRIDT
ERLLILQVTERLAQMKQEGTYTGVFSSIAHFFGYEGRCAFPSNFDADYCY
TLGLTACLLAVHRFTGYVASVRNLTSSVAEWAVGGVPLTMLMNMERRHGS
QKPVIKKALVDLEGMPFRVFSRRRASWALKTSYVYPGAVQYYGPPAVCDE
PSVTIRLERPAPAANSSFGHRSS

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGTATTTCTCTCTTGCAACAGGAACGGCATCGCTACCTGCCAAAGGT
CCCCGATCTTCTTCGGGGGGACTTTCGGCGCGTTTGTGCGCGTCGCGGCT
TATCCACCACTGCGGTGGCAGACTATGACGCGTTGCGCTCTCTTTTTGCG
CGGACCTACGGTCAGCCGCTGGTGAACTTCGTTAATGCTAGTGAGAAAAA
CGAAGATTCCCCCATGGAGACTGCACCTGAGCCGCGAGGATTACGTGTTG
CCATAGTACTCTCAGGGGGTCAGGCACCAGGTGGTCACAACGTTATAGCA
GGGCTTTTCGACGGATTAAAACGATGGCACGCTGACTCTGTCCTTATCGG
TTTTCTAGGCGGTCCTGCGGGCGTGCTTTCTGGCGATCATATCGAGATAT
GCGCAGACCGTGTAGATGCGTACCGCAACACAGGTGGCTTTGACCTCATT
GGTTCAGGACGCACCAAAATCGAAAGTGAGTCCCAGTTTGCCGCCGCGGC
GCAGACAGTCACGCGTATGGCGCTTGATGCACTCGTAGTTGTAGGAGGTG
ATGACTCCAACACGAACGCTGCCCTTTTGGCAGAACACTTCGTAAACAGT
GGTATTTCTACCAAGGTTATCGGTGTTCCCAAAACTATTGACGGAGACTT
GAAAAATGAGGCGATAGAAACCTCGTTTGGTTTTGACACTGCCACAAAAA
CATACAGTGAACTTATCGGGAACATTGCGCGCGATGCGTGCAGTGCCCGC
AAGTACTGGCATTTTATTAAGCTCATGGGGCGTTCAGCCAGTCATATTGC
GCTTGAGTGCGCGCTGAAAACACAGCCAAATGTCTGTCTCATTTCGGAAG
AAGTAGCGGCGCAATCGTTAACGCTCGCACAGATCGTGCAGTCGTTGTGT
GACACCATCGCCACGCGCGCACAACACGGTGAGCACTTTGGTATAGTGTT
AGTTCCAGAAGGACTTATCGAATTTATACCTGAAATGAAGGCTCTAATTA
CGGAGCTCAACGAGGTGATGGCACGCCGCGCGCAGGAATTTGAGGCGCTG
GACACTCCTGACGCGCAGCGCGTTTGGATAGAGCAGGCGTTGTCTGCTTC
TGCTCGTGCGGTGTTTAACGCATTACCTGCTGAAATTTCCACACAGCTTT
TGGCAGATCGGGATCCACATGGGAATGTGCAGGTGTCGCGCATTGACACA
GAGCGTTTGCTCATTCTCCAGGTAACGGAGCGCTTAGCGCAGATGAAGCA
GGAAGGTACGTACACCGGTGTTTTTTCCAGCATTGCTCATTTTTTTGGTT
ACGAAGGGCGATGCGCTTTTCCGTCCAACTTTGATGCAGATTATTGCTAT
ACGCTCGGTTTGACCGCGTGTCTTCTGGCCGTGCACAGGTTTACAGGGTA
CGTAGCGTCGGTGCGTAACTTGACGTCTTCTGTAGCTGAGTGGGCAGTAG
GTGGCGTGCCGCTTACTATGCTCATGAACATGGAGCGCCGACATGGAAGT
CAAAAGCCGGTGATAAAAAAGGCGCTGGTTGACCTGGAGGGCATGCCGTT
TCGGGTGTTCTCTCGTCGGCGTGCGAGTTGGGCCTTAAAAACAAGCTACG
TGTATCCGGGGGCGGTACAGTATTATGGACCTCCGGCTGTGTGTGACGAA
CCTTCAGTAACTATACGCCTTGAGCGGCCCGCCCCTGCGGCGAATTCCTC
ATTTGGGCACCGGTCATCC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy