Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap tRNA-Asn-1 IGR388 IGR382 IGR390 IGR389 IGR387 IGR383 IGR384 IGR385 IGR386 TP0535 TP0536 ruvA, - TP0543 tpi, - TP0537 pgk, - TP0538 atpI, - TP0533 pfpB, - TP0542 TP0544 TP0539 TP0540 era, - TP0541 TP0535 TP0536 ruvA, - TP0543 tpi, - TP0537 pgk, - TP0538 atpI, - TP0533 pfpB, - TP0542 TP0544 TP0539 TP0540 era, - TP0541 TP0536 ruvA, - TP0543 tpi, - TP0537 pgk, - TP0538 atpI, - TP0533 pfpB, - TP0542 TP0544 TP0534 TP0534 TP0535 TP0540 era, - TP0541 TP0539
* Calculated from Protein Sequence

Gene ID: TP0539

DNA Molecule Name:
1  

Genbank ID:
3322836

Gene Name:


Definition:
hypothetical protein

Gene Start:
581186

Gene Stop:
581404

Gene Length:
219

Molecular Weight*:
7861

pI*:
7.56

Net Charge*:
1.08

EC:
 

Functional Class:
Hypothetical  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No significant hits in gapped BLAST.

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
NONE.

ProDom Summary:  Protein Domain Search
NONE.

Paralogs:  Local Blast Search
No evidence of paralogs in T.pallidum.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
45  
70

PDB Hit:
none

Gene Protein Sequence:
MTSLQVLSIISSFLTQGLPHPPHVAADSHYISKKDSISASVGRLTSLLPC
LCALHAYGVGHRPFVIVDIFYAE

Gene Nucleotide Sequence:  Sequence Viewer
GTGACATCTTTACAAGTTCTCAGCATCATCTCCTCCTTTTTGACGCAGGG
GTTACCCCATCCGCCACACGTTGCGGCTGATTCTCACTATATTTCAAAAA
AAGATTCAATATCCGCATCGGTCGGACGCCTCACATCACTGCTCCCCTGC
CTGTGCGCCCTACACGCGTACGGGGTGGGGCACAGACCCTTCGTCATTGT
TGACATTTTCTATGCGGAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy