Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap tRNA-Asn-1 IGR388 IGR382 IGR389 IGR387 IGR383 IGR384 IGR385 IGR381 IGR386 TP0535 TP0536 TP0532 ruvA, - TP0543 tpi, - TP0537 pgk, - TP0538 atpI, - TP0533 pfpB, - TP0542 TP0539 TP0540 era, - TP0541 TP0535 TP0536 TP0532 ruvA, - TP0543 tpi, - TP0537 pgk, - TP0538 atpI, - TP0533 pfpB, - TP0542 TP0539 TP0540 era, - TP0541 TP0536 TP0532 ruvA, - TP0543 tpi, - TP0537 pgk, - TP0538 atpI, - TP0533 pfpB, - TP0542 TP0534 TP0534 TP0535 TP0540 era, - TP0541 TP0539
* Calculated from Protein Sequence

Gene ID: TP0538

DNA Molecule Name:
1  

Genbank ID:
3322829

Gene Name:
pgk  

Definition:
phosphoglycerate kinase

Gene Start:
581214

Gene Stop:
579958

Gene Length:
1257

Molecular Weight*:
44933

pI*:
7.16

Net Charge*:
1.01

EC:
2.7.2.3  

Functional Class:
Energy metabolism; Glycolysis  

Pathway: pathway table
Carbohydrate metabolism; Glycolysis / Gluconeogenesis
Energy metabolism; Carbon fixation

Secondary Evidence:
Wassenberg D, Wuhrer M, Beaucamp N, Schurig H, Wozny M, Reusch D, Fabry S, Jaenicke R.
Local variability of the phosphoglycerate kinase-triosephosphate isomerase fusion protein from Thermotoga maritima MSB 8.
Biol Chem. 2001 Apr;382(4):693-7.
PMID: 11405233

Crowhurst G, McHarg J, Littlechild JA.
Phosphoglycerate kinases from bacteria and archaea.
Methods Enzymol. 2001;331:90-104.
PMID: 11265486

Yu JS, Noll KM.
Phosphoglycerate kinase-triose-phosphate isomerase complex from Thermotoga neapolitana.
Methods Enzymol. 2001;331:78-89.
PMID: 11265485

Auerbach G, Huber R, Gr├Ąttinger M, Zaiss K, Schurig H, Jaenicke R, Jacob U.
Closed structure of phosphoglycerate kinase from Thermotoga maritima reveals the catalytic mechanism and determinants of thermal stability.
Structure. 1997 Nov;5(11):1475-83.
PMID: 9384563

Leyva-Vazquez MA, Setlow P.
Cloning and nucleotide sequences of the genes encoding triose phosphate isomerase, phosphoglycerate mutase, and enolase from Bacillus subtilis.
J Bacteriol. 1994 Jul;176(13):3903-10.
PMID: 8021172

Comment:
Reaction:
ATP + 3-PHOSPHO-D-GLYCERATE = ADP + 3-PHOSPHO-D-GLYCEROYL PHOSPHATE.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to phosphoglycerate
kinases. For example residues 5-418 are 47% similar to PGKY_WHEAT,
phosphoglycerate kinase of wheat,(X15232). In addition residues
1-418 are 46% similar to PGK_BORBU, phosphoglycerate kinase of
Borrelia burgdorferi,(U28760).

COGS Summary:  COGS Search
BeTs to 16 clades of COG0126
COG name: 3-phosphoglycerate kinase
Functional Class:? G
The phylogenetic pattern of COG0126 is amtkyqvcebrhujgpolin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 10-26, 55-66, 91-114, 128-142, 162-182, 344-364, 191-237,
257-296, 320-355, 373-417, 217-261, and 218-262 represent significant
(100%) hits to blocks BL00111A,B,C,D,E,F,G,H,I, Phosphoglycerate kinase
proteins. Residues 20-33 represent a significant (97%) hit to
blocks PR00732C, GLYCOSYL HYDROLASE FAMILY 4 SIGNATURE. Residues
81-91 represent a significant (96%) hit to blocks BL00821E, Cytochrome
c and c1 heme lyases proteins.

ProDom Summary:  Protein Domain Search
Residues 105-411 are 52% similar to phosphoglycerate kinase of
PGKY_WHEAT. Residues 14-64, 88-101, and 369-417 also support this
match.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 1 to 418 (E-value = 4.1e-184) place TP0538 in the PGK family which is described as Phosphoglycerate kinase (PF00162)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
329  
419

PDB Hit:
gi|2781023|pdb|13PK|A Chain A, Ternary Complex Of Phosphoglycerate Kinase From Trypanosoma Brucei Kinase, Phosphoglycerate, Ternary Complex, Glycolysis, Transferase Mol_id: 1; Molecule: 3-Phosphoglycerate Kinase; Chain: A, B, C, D; Synonym: Pgk; Ec: 2....

Gene Protein Sequence:
MMLRTCKDVTMRGERVVVRVDFNVPMRDGMVQDDTRVTAAVPTLRYIIEQ
GPRHVVLISHLGDPTRDADKAEGNAKKDGCPFDRHAFINGKHRLKPVADC
LAKKLGVPVHFAPSCVGQREFIEGLPDGSVVLLENVRFHPEETSGDAKVQ
EQFARELAQYGDIFVNDAFGTAHREHASTVVLPRLMRRRVAGLLIEREVR
YLEPMVCNPKVPMVAVVGGAKVSSKIAVLESLLRTSTALIIGGGMAYTFL
KAQGVGVGTSLVEDDFIDTARMLLQKAQSGGVSVVLPVDHVCASTFCADA
QPVAVDDVHIPMHLMGMDVGPRTLEQYRAHLKGVSSVLWNGPVGVFEFDA
FAHGTRVLAQLIAEATDAGATSVVGGGDSIAAVSKFGLASRMSHVSTGGG
ASLKLFEGKVLPGISCLET

Gene Nucleotide Sequence:  Sequence Viewer
ATGATGCTGAGAACTTGTAAAGATGTCACAATGCGAGGTGAGCGTGTTGT
CGTGCGTGTTGATTTTAACGTACCGATGCGTGATGGTATGGTGCAAGACG
ACACGCGCGTCACTGCAGCAGTTCCTACTCTGCGGTACATCATCGAGCAG
GGGCCGCGACACGTAGTGCTCATTAGCCATCTTGGAGACCCTACCCGTGA
TGCGGATAAAGCAGAGGGGAACGCTAAGAAAGATGGTTGTCCCTTTGACC
GCCACGCATTCATTAACGGCAAACACCGGCTTAAGCCGGTTGCGGACTGC
CTTGCAAAGAAGTTGGGGGTGCCGGTGCATTTTGCGCCTTCCTGCGTCGG
GCAGCGTGAATTTATTGAAGGGCTGCCCGACGGTTCGGTAGTGCTTTTGG
AGAATGTGCGCTTTCACCCCGAGGAAACATCTGGTGATGCGAAGGTGCAG
GAGCAATTTGCGCGGGAGCTTGCCCAGTATGGGGACATTTTTGTTAATGA
TGCGTTCGGCACTGCGCACCGTGAACATGCATCTACGGTGGTACTCCCGA
GACTTATGCGTCGCAGAGTGGCCGGTCTTTTGATAGAGCGGGAAGTGAGG
TACCTGGAACCTATGGTATGCAACCCGAAGGTGCCAATGGTGGCGGTTGT
CGGTGGTGCCAAGGTATCTTCTAAGATAGCAGTCTTGGAGAGTCTGCTTC
GAACATCGACGGCGCTTATCATCGGGGGAGGGATGGCATACACCTTTTTG
AAAGCGCAAGGTGTGGGTGTAGGTACCTCCCTAGTGGAGGATGACTTTAT
CGACACTGCACGTATGCTGTTGCAAAAGGCTCAAAGCGGTGGTGTGTCGG
TGGTATTGCCGGTCGATCACGTATGTGCGTCCACGTTCTGTGCGGATGCG
CAGCCGGTTGCGGTGGACGATGTGCATATTCCTATGCACTTGATGGGTAT
GGATGTTGGTCCGCGTACGCTTGAGCAGTATCGTGCGCATTTAAAGGGAG
TGAGCTCCGTGTTGTGGAATGGTCCGGTAGGGGTTTTTGAGTTCGATGCC
TTTGCACACGGTACACGGGTGCTTGCGCAGTTGATAGCAGAGGCGACGGA
TGCGGGTGCTACGTCGGTAGTTGGTGGAGGAGACTCTATTGCAGCAGTCA
GCAAGTTTGGGCTTGCAAGTCGCATGAGCCATGTATCTACGGGGGGTGGC
GCATCGCTGAAGCTCTTTGAGGGTAAAGTTTTACCGGGCATTTCGTGTCT
TGAAACA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy