Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap tRNA-Asn-1 IGR388 IGR380 IGR382 IGR379 IGR387 IGR383 IGR384 IGR385 IGR381 IGR386 TP0535 atpF, - TP0531 TP0536 TP0532 TP0530 tpi, - TP0537 pgk, - TP0538 atpI, - TP0533 pfpB, - TP0542 TP0539 TP0540 era, - TP0541 TP0535 atpF, - TP0531 TP0536 TP0532 TP0530 tpi, - TP0537 pgk, - TP0538 atpI, - TP0533 pfpB, - TP0542 TP0539 TP0540 era, - TP0541 TP0536 TP0532 TP0530 tpi, - TP0537 pgk, - TP0538 atpI, - TP0533 pfpB, - TP0542 TP0534 TP0534 TP0535 atpF, - TP0531 TP0540 era, - TP0541 TP0539
* Calculated from Protein Sequence

Gene ID: TP0537

DNA Molecule Name:
1  

Genbank ID:
3322828

Gene Name:
tpi  

Definition:
triosephosphate isomerase

Gene Start:
579804

Gene Stop:
579058

Gene Length:
747

Molecular Weight*:
26526

pI*:
6.60

Net Charge*:
-2.06

EC:
5.3.1.1  

Functional Class:
Energy metabolism; Glycolysis  

Pathway: pathway table
Carbohydrate metabolism; Fructose and mannose metabolism
Carbohydrate metabolism; Glycolysis / Gluconeogenesis
Energy metabolism; Carbon fixation
Metabolism of complex lipids; Glycerolipid metabolism

Comment:
This enzyme is involved in several metabolic pathways.

Reaction:
D-GLYCERALDEHYDE 3-PHOSPHATE = DIHYDROXY-ACETONE PHOSPHATE.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to triosephosphate
isomerase. For example residues 2-247 are 51% similar to triosephosphate
isomerase of Thermotoga maritima,(L27492).

COGS Summary:  COGS Search
BeTs to 16 clades of COG0149
COG name: Triosephosphate isomerase
Functional Class:  G
The phylogenetic pattern of COG0149 is amtkyqvcebrhujgpolin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 2-15, 62-115, 24-77, 158-190, 206-238, and 28-60 represent
significant (100%) hits to blocks BL00171A,B,C,D, Triosephosphate
isomerase proteins.

ProDom Summary:  Protein Domain Search
Residues 9-237 are 47% similar to triosephosphate isomerase of
TPIS_BACST.


Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 2 to 248 (E-value = 1.7e-103) place TP0537 in the TIM family which is described as Triosephosphate isomerase (PF00121)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
48  
155
non-globular  
198  
249

PDB Hit:
gi|1431731|pdb|1BTM|A Bacillus stearothermophilus

Gene Protein Sequence:
MRGYFIAGNWKMHKTCAEAVALAQELVRELRGGPHTYMIAPSFTALDAVG
KVLRGSNVLLGAQDVSSEEWGAHTGEVSVLQLEDLGVQVVIVGHSERRHG
RGENDKLINQKVRRVLESGLRVILCVGERLQEYEAGCTNEVVGTQVRAGM
ADVCGSLMHNVTVAYEPVWAIGTGKTATPAQANAVHAHIRSVVREMYGAA
IAEALCIQYGGSMKAENARALLAEEHIDGGLIGGASLEAASFVPIARSV

Gene Nucleotide Sequence:  Sequence Viewer
ATGCGCGGCTATTTTATCGCGGGGAATTGGAAGATGCATAAAACGTGTGC
GGAGGCGGTGGCGCTTGCGCAGGAACTCGTGCGGGAATTACGGGGTGGTC
CGCACACATACATGATTGCGCCGAGTTTTACCGCTTTAGACGCGGTGGGG
AAGGTGCTACGGGGAAGTAACGTACTTCTTGGCGCGCAGGACGTGAGTAG
TGAAGAGTGGGGGGCGCATACTGGAGAGGTATCCGTCCTTCAACTCGAAG
ACCTGGGGGTACAGGTAGTCATCGTGGGGCATTCCGAACGGCGTCATGGG
CGTGGGGAGAATGATAAGCTTATCAATCAAAAGGTCAGACGCGTGTTAGA
AAGCGGTTTGCGCGTCATCTTATGCGTCGGCGAACGACTCCAAGAGTATG
AAGCGGGGTGTACCAACGAGGTAGTGGGAACTCAAGTGCGCGCAGGGATG
GCAGACGTGTGTGGGTCACTCATGCATAATGTAACTGTTGCGTATGAGCC
TGTGTGGGCAATTGGTACGGGTAAGACTGCCACTCCGGCACAGGCGAATG
CGGTTCATGCTCATATTCGGTCAGTAGTCCGCGAGATGTACGGCGCGGCT
ATCGCAGAGGCACTGTGTATTCAATACGGCGGATCCATGAAAGCGGAGAA
CGCGCGGGCACTGTTGGCTGAAGAGCACATTGACGGGGGACTCATTGGCG
GTGCTTCGCTGGAGGCTGCGTCTTTTGTTCCTATCGCGCGCAGCGTG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy