Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap tRNA-Asn-1 IGR380 IGR382 IGR379 IGR383 IGR384 IGR385 IGR381 IGR386 TP0535 atpF, - TP0531 TP0536 TP0532 TP0530 tpi, - TP0537 pgk, - TP0538 atpI, - TP0533 atpB, - TP0528 atpA, - TP0529 TP0539 TP0535 atpF, - TP0531 TP0536 TP0532 TP0530 tpi, - TP0537 pgk, - TP0538 atpI, - TP0533 atpB, - TP0528 atpA, - TP0529 TP0539 TP0536 TP0532 TP0530 tpi, - TP0537 pgk, - TP0538 atpI, - TP0533 atpB, - TP0528 atpA, - TP0529 TP0534 TP0534 TP0535 atpF, - TP0531 TP0539
* Calculated from Protein Sequence

Gene ID: TP0533

DNA Molecule Name:
1  

Genbank ID:
3322824

Gene Name:
atpI  

Definition:
possible V-type ATPase subunit I

Gene Start:
577129

Gene Stop:
575768

Gene Length:
1362

Molecular Weight*:
50836

pI*:
8.03

Net Charge*:
8.64

EC:
3.6.1.34  

Functional Class:
Energy metabolism; ATP-proton motive force interconversion  

Pathway: pathway table
Miscellaneous Enzymes

Comment:
V-type ATPases (more correctly the V-F0F1 type ATPases) are one of two
subgroups of the F0F1-ATPases (the other subgroup being the F-F0F1 type).
The V subgroup are found mainly in archaebacteria and the endomembrane
or vacuolar system of eukaryotic cells. However, there are examples of
V types in eubacteria such as the ntp cluster in Enterococcus hirae.
This cluster is believed to encode a Na-translocating V-type ATPase that
is expressed when the normal F-type ATPase is inoperative.

See TP0424 atpE
See TP0426 atpA
See TP0427 atpB
See TP0428 atpD
See TP0429 atpI
See TP0430 atpK
See TP0527 atpD
See TP0528 atpB
See TP0529 atpA
See TP0531 atpF
See TP0532 atpK

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed the middle region had several significant hits
to V-type ATPase subunit I. For example residues 164-378 are 23% similar
to ATPI_METJA, H+-transporting ATP synthase subunit I of Methanococcus
jannaschii,(U67478).

COGS Summary:  COGS Search
BeTs to 6 clades of COG1269
COG name: Archaeal/vacuolar-type H+-ATPase subunit I
Functional Class:  C
The phylogenetic pattern of COG1269 is amtkY-----------oLin-
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
Residues 325-337 represent a significant (97%) hit to block BL00341F,
Surfactant associated polypeptide SP-C palmitoylation site proteins.
Residues 356-381, 252-277, 240-263, 353-375, 351-372 represent
significant (96%) hits to blocks PR00697B,D,E,F, C.ELEGANS SRA FAMILY
INTEGRAL MEMBRANE PROTEIN SIGNATURE.

ProDom Summary:  Protein Domain Search
Residues 212-259 are 31% similar to V-type ATPase, subunit I of
ATPI_METJA.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
245  
277
transmembrane  
292  
326
transmembrane  
346  
377
transmembrane  
420  
451

PDB Hit:
none

Gene Protein Sequence:
MFRSQRMKFLELVVLERDVDRVLEYLGKTALVHLRLSAAARGSSSHCAQS
KEYVGRLEEACKYLGVSGECAFSPGDSLPTEEDYTLAQQILAEVDALHAR
EREGDAPSVPRGKSSVAHDSANEEQFQGEKCALGSMRGPALCALLRRFAL
QERVHRTRDALESTRHTYRIAGWLPAHEAKDLVAGLDNVTTGRMAVRLFE
PQELSFIRDGSEHVPVCYQHGRFVRSYERMVSSYGCPPYGLVDPTPFVAF
SYALLFGIMFGDLGQGLLFFVLGLLLRTRRVRALNRWAHLDYVFLSVGFS
SMVMGFLTGEFFAHGTLLAPLIRSVTALCGGVPRDHILHLMPSHGSLHTL
MAFFGFTLFLGFVINSLGLIINIVNQVRLRHALQQCVQKRECADSSFFGT
WLPLQCAYHFLEFHSGSLMRLQWACLSWVFFVKSFWSVCASVCVRGFLKV
LACI

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTTAGATCGCAGAGGATGAAGTTCCTCGAACTTGTAGTGCTTGAACG
GGATGTGGACCGAGTACTGGAGTACCTGGGAAAGACGGCGCTTGTCCATT
TGCGTCTTTCCGCCGCGGCGCGTGGCAGTTCTTCCCACTGTGCGCAGAGC
AAAGAGTATGTCGGCCGTCTTGAAGAAGCGTGTAAGTACCTGGGTGTCTC
TGGCGAGTGCGCGTTTTCTCCAGGGGATTCTTTGCCTACCGAAGAAGACT
ACACGTTGGCACAGCAGATACTTGCAGAAGTTGACGCTTTGCACGCACGC
GAACGAGAGGGTGATGCTCCCTCAGTTCCCCGTGGGAAGAGTTCTGTAGC
CCATGATTCTGCCAACGAAGAGCAGTTTCAGGGTGAGAAATGTGCGCTCG
GCTCGATGCGAGGCCCGGCACTGTGTGCGCTGCTTAGGCGTTTTGCGCTG
CAGGAACGTGTGCACCGCACGCGTGATGCGCTTGAGTCTACCCGGCATAC
CTATCGTATAGCTGGCTGGTTGCCAGCACATGAGGCGAAGGACCTCGTTG
CAGGATTGGACAACGTGACCACAGGGAGGATGGCAGTCCGCCTGTTTGAA
CCACAGGAGCTGTCTTTTATCAGGGATGGCAGCGAGCATGTGCCGGTGTG
TTACCAGCATGGCCGTTTTGTGCGTAGTTACGAGCGTATGGTGTCTAGTT
ATGGTTGTCCCCCCTACGGGCTCGTCGATCCGACTCCTTTCGTTGCTTTC
TCCTATGCGCTGCTTTTTGGGATTATGTTTGGGGACCTCGGGCAGGGTCT
CCTCTTTTTCGTACTTGGTTTGCTACTGCGGACGCGGCGTGTACGTGCGC
TAAATAGATGGGCACACCTTGACTACGTGTTCTTGTCCGTAGGTTTCTCT
AGCATGGTGATGGGTTTTCTGACGGGGGAGTTTTTCGCTCATGGTACGCT
CCTCGCTCCGTTGATTCGCAGCGTTACTGCGCTATGTGGTGGAGTACCAC
GCGATCACATCTTGCACCTAATGCCTTCTCATGGCTCTCTGCACACGCTT
ATGGCCTTTTTCGGCTTCACGCTTTTTTTAGGATTTGTTATTAATTCGCT
GGGCCTTATCATCAACATTGTCAATCAGGTGAGACTGCGCCATGCGTTGC
AGCAGTGTGTTCAAAAACGGGAGTGTGCGGACTCCTCTTTTTTTGGTACA
TGGTTGCCCTTGCAGTGCGCATACCACTTTTTGGAATTCCATTCGGGGTC
TTTGATGCGGTTGCAATGGGCGTGCCTCTCGTGGGTATTTTTTGTCAAGA
GTTTTTGGAGCGTGTGTGCAAGCGTGTGCGTCCGTGGTTTCCTGAAGGTG
TTGGCATGTATC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy