Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR380 IGR382 IGR379 IGR377 IGR378 IGR383 IGR384 IGR385 IGR381 TP0535 atpF, - TP0531 TP0536 TP0532 TP0530 atpD, - TP0527 tpi, - TP0537 pgk, - TP0538 atpI, - TP0533 atpB, - TP0528 atpA, - TP0529 hrpA, - TP0526 TP0535 atpF, - TP0531 TP0536 TP0532 TP0530 atpD, - TP0527 tpi, - TP0537 pgk, - TP0538 atpI, - TP0533 atpB, - TP0528 atpA, - TP0529 hrpA, - TP0526 TP0536 TP0532 TP0530 atpD, - TP0527 tpi, - TP0537 pgk, - TP0538 atpI, - TP0533 atpB, - TP0528 atpA, - TP0529 TP0534 TP0534 TP0535 atpF, - TP0531 hrpA, - TP0526
* Calculated from Protein Sequence

Gene ID: TP0531

DNA Molecule Name:
1  

Genbank ID:
3322823

Gene Name:
atpF  

Definition:
possible V-type ATPase subunit F

Gene Start:
575145

Gene Stop:
574810

Gene Length:
336

Molecular Weight*:
12478

pI*:
7.51

Net Charge*:
0.86

EC:
3.6.1.34  

Functional Class:
Energy metabolism; ATP-proton motive force interconversion  

Pathway: pathway table
Miscellaneous Enzymes

Comment:
V-type ATPases (more correctly the V-F0F1 type ATPases) are one of two
subgroups of the F0F1-ATPases (the other subgroup being the F-F0F1 type).
The V subgroup are found mainly in archaebacteria and the endomembrane
or vacuolar system of eukaryotic cells. However, there are examples of
V types in eubacteria such as the ntp cluster in Enterococcus hirae.
This cluster is believed to encode a Na-translocating V-type ATPase that
is expressed when the normal F-type ATPase is inoperative.

See TP0424 atpE
See TP0426 atpA
See TP0427 atpB
See TP0428 atpD
See TP0429 atpI
See TP0430 atpK
See TP0527 atpD
See TP0528 atpB
See TP0529 atpA
See TP0530 atpE
See TP0532 atpK
See TP0533 atpI

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed only one significant hit in the database.
Residues 12-112 are 29% similar to ATP synthase, subunit F of
Methanobacterium thermoautotrophicum,(AE000869).

COGS Summary:  COGS Search
BeTs to 5 clades of COG1436
COG name: Archaeal/vacuolar-type H+-ATPase subunit F (NtpG, VMA7)
Functional Class:  C
The phylogenetic pattern of COG1436 is amtky------------l---
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 12 to 107 (E-value = 3.1e-05) place TP0531 in the ATP-synt_F family which is described as ATP synthase (F/14-kDa) subunit (PF01990)

PDB Hit:
none

Gene Protein Sequence:
MRLGCHQVTYCIIGEQELVLGFSLVGVHGFVVHSPEEAARAFSQVTRPPS
GDRPAQVLILTQRAMSYLREEVRAWQMQGELPFVVEVPALHEQGNVRTSL
RESIRQVIGAKV

Gene Nucleotide Sequence:  Sequence Viewer
GTGCGTCTGGGGTGTCATCAAGTGACGTATTGCATAATTGGAGAGCAAGA
ACTGGTGTTGGGTTTTTCCTTAGTAGGGGTGCACGGTTTCGTGGTACATT
CTCCAGAGGAGGCGGCGCGCGCATTCTCCCAGGTCACGCGTCCCCCCTCT
GGAGACCGTCCCGCGCAGGTCCTCATACTCACCCAGCGCGCTATGTCTTA
CCTGAGAGAGGAGGTGCGTGCGTGGCAGATGCAGGGGGAGTTACCCTTTG
TCGTAGAAGTCCCCGCTTTGCACGAACAGGGGAACGTACGCACGTCCCTG
CGTGAATCAATTCGACAGGTTATCGGGGCAAAGGTA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy