Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR380 IGR382 IGR379 IGR377 IGR378 IGR381 TP0535 atpF, - TP0531 TP0532 TP0530 atpD, - TP0527 atpI, - TP0533 atpB, - TP0528 atpA, - TP0529 hrpA, - TP0526 TP0535 atpF, - TP0531 TP0532 TP0530 atpD, - TP0527 atpI, - TP0533 atpB, - TP0528 atpA, - TP0529 hrpA, - TP0526 TP0532 TP0530 atpD, - TP0527 atpI, - TP0533 atpB, - TP0528 atpA, - TP0529 TP0534 TP0535 atpF, - TP0531 TP0534 hrpA, - TP0526
* Calculated from Protein Sequence

Gene ID: TP0529

DNA Molecule Name:
1  

Genbank ID:
3322821

Gene Name:
atpA  

Definition:
V-type ATPase subunit A

Gene Start:
574178

Gene Stop:
572364

Gene Length:
1815

Molecular Weight*:
66732

pI*:
5.55

Net Charge*:
-9.38

EC:
3.6.1.34  

Functional Class:
Energy metabolism; ATP-proton motive force interconversion  

Pathway: pathway table
Miscellaneous Enzymes

Comment:
V-type ATPases (more correctly the V-F0F1 type ATPases) are one of two
subgroups of the F0F1-ATPases (the other subgroup being the F-F0F1 type).
The V subgroup are found mainly in archaebacteria and the endomembrane
or vacuolar system of eukaryotic cells. However, there are examples of
V types in eubacteria such as the ntp cluster in Enterococcus hirae.
This cluster is believed to encode a Na-translocating V-type ATPase that
is expressed when the normal F-type ATPase is inoperative.

See TP0424 atpE
See TP0426 atpA
See TP0427 atpB
See TP0428 atpD
See TP0429 atpI
See TP0430 atpK
See TP0527 atpD
See TP0528 atpB
See TP0531 atpF
See TP0532 atpK
See TP0533 atpI

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to V-type ATPase
subunit A. For example residues 9-520 are 51% similar to V-ATPase A
subunit of Desulfurococcus sp. SY,(U96487).

COGS Summary:  COGS Search
BeTs to 8 clades of COG1155
COG name: Vacuolar ATPase/archaeal ATP synthase A subunit (NtpA)
Functional Class:  C
The phylogenetic pattern of COG1155 is amtKY-----------oLin-
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
Residues 72-97, 195-220, 318-329, 367-378, 337-381, and 408-445 represent
significant (100%) hits to blocks BL00152A,B,C,D, ATP synthase alpha and
beta subunits proteins. Residues 333-346 represent a significant (99%)
hit to block BL01066A, Uncharacterized protein family UPF0015 proteins.

ProDom Summary:  Protein Domain Search
Residues 299-482 are 61% similar to V-type ATPase, subunit A of
ATPA_SULAC. Residues 141-193, 223-270, 271-296, 484-517, and 511-550
also support this match.

Paralogs:  Local Blast Search
This protein is paralogously related to TP0426, V-type ATPase,
subunit A, TP0402, flagellum-specific ATP synthase, TP0528
V-type ATPase, subunit B, TP0427, V-type ATPase, subunit B
TP0254, transcription termination factor Rho.

Pfam Summary:  Pfam Search
Residues 11 to 73 (E-value = 5.8e-15) place TP0529 in the ATP-synt_ab_N family which is described as ATP synthase alpha/beta family, beta-barrel domain (PF02874)
Residues 261 to 449 (E-value = 8.7e-87) place TP0529 in the ATP-synt_ab family which is described as ATP synthase alpha/beta family, nucleotide-binding domain (PF00006)
Residues 461 to 592 (E-value = 5.3e-29) place TP0529 in the ATP-synt_ab_C family which is described as ATP synthase alpha/beta chain, C terminal domain (PF00306)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
312  
497

PDB Hit:
none

Gene Protein Sequence:
MIKDDVVTGRVVRVSGPIVYAEGLSACSVYDVVDVGEASLIGEIIRLDES
KAVVQVYEDDTGMRVGEKVTSLRRPLSVRLGPGLIGTIYDGIQRPLERLF
QEDGAFLRPGARSQPLDGSVRWDFRPHCNERGEALCAGIPIAPGSVLGTV
QETPSVVHTIMVPPDIRGSVLSSFKGAGAYTIDEEIGRTDLGEPLFLSQY
WPVRRARPFSKKLAVCEPLVTGQRAIDVFFPLSKGGTAAIPGGFGTGKTM
TQHAVAKWCDADIIVYIGCGERGNEMTDVLSEFPKLIDPRTGRSLMERTI
LIANTSNMPVSAREVSLYSGITLAEYYRDMGMHVAIMADSTSRWAEALRE
LSGRMEEMPAEEGFPAYLPTRLAEFYERAGRVETCVAREGSVSIIGAVSP
LGGDFSEPVTQHTKRFIRCFWALDRELAHARHYPAIGWIDSYSEYAQEVS
AWWSKYDPRAGALRAAALDLLRKEQRLQQIVRLVGPDALPGEDRLVLMVC
EMIKGGFLQQNAFDPTDVFSCPEKQVQILRTIVDFHERAVVLLRAGISLS
ALSQLSCRELIVRMKTTYGNEDVHKMQKVYDTMCTEFDQLSVCAAARTQG
GEKVE

Gene Nucleotide Sequence:  Sequence Viewer
GTGATCAAAGACGATGTGGTTACAGGCCGTGTAGTGAGGGTGTCTGGTCC
CATTGTGTATGCCGAGGGCCTCTCTGCGTGCAGCGTATACGATGTTGTCG
ACGTAGGGGAAGCATCGCTCATCGGAGAAATTATCCGGTTGGATGAGAGC
AAGGCGGTCGTGCAAGTATACGAGGATGACACAGGTATGCGAGTCGGGGA
GAAGGTGACAAGCTTGCGTCGACCACTCTCAGTCCGCTTAGGGCCTGGAT
TAATCGGCACCATTTATGACGGTATTCAGCGCCCACTTGAGCGCCTCTTC
CAAGAAGACGGCGCCTTCTTGCGTCCTGGTGCGCGTTCACAACCGCTTGA
TGGCTCCGTACGCTGGGATTTTCGTCCTCATTGTAACGAGCGCGGTGAGG
CCCTGTGCGCGGGGATTCCGATTGCACCTGGGTCAGTGTTAGGGACCGTG
CAGGAGACTCCTTCTGTTGTGCACACTATCATGGTTCCTCCTGACATCCG
GGGGAGCGTGCTATCTTCGTTCAAGGGCGCAGGTGCTTACACAATAGATG
AAGAAATTGGACGCACTGATCTTGGTGAGCCGCTTTTTCTATCCCAGTAC
TGGCCAGTGCGTCGTGCGCGTCCTTTCAGCAAAAAACTTGCAGTGTGTGA
GCCACTAGTTACTGGACAGCGGGCGATTGATGTTTTCTTCCCCCTATCAA
AGGGAGGAACGGCGGCTATTCCAGGGGGATTTGGAACTGGGAAGACAATG
ACGCAGCATGCCGTTGCCAAGTGGTGTGATGCAGATATTATCGTGTACAT
CGGCTGCGGAGAGCGGGGCAACGAGATGACAGACGTGCTCTCTGAATTTC
CCAAACTCATCGATCCGCGCACAGGACGCTCTCTTATGGAGCGGACGATT
TTGATCGCAAATACGTCCAATATGCCTGTGTCCGCACGCGAGGTGTCGCT
GTATTCAGGGATTACCCTTGCGGAATACTACCGTGATATGGGTATGCATG
TGGCCATCATGGCTGATTCTACCAGCCGCTGGGCGGAGGCGCTGCGTGAA
TTGTCTGGGCGCATGGAAGAAATGCCTGCGGAGGAGGGATTCCCTGCGTA
CCTTCCGACGCGTCTTGCAGAATTTTATGAGCGCGCAGGACGCGTGGAAA
CCTGTGTGGCGCGCGAGGGCTCTGTGAGCATCATTGGTGCTGTTTCTCCC
CTGGGTGGAGATTTCTCTGAGCCGGTGACGCAGCACACAAAGCGCTTCAT
CCGTTGCTTTTGGGCCTTGGATCGTGAACTTGCACACGCGCGTCATTACC
CTGCCATTGGGTGGATAGATTCATACTCTGAATATGCGCAGGAAGTAAGT
GCATGGTGGAGTAAGTATGACCCGCGCGCAGGCGCGTTGCGCGCCGCAGC
CTTGGATTTGCTGAGAAAGGAACAGCGGTTACAGCAAATTGTCAGGCTTG
TCGGTCCTGATGCGCTGCCTGGAGAAGATCGTCTGGTGCTAATGGTGTGT
GAAATGATCAAAGGTGGCTTTCTGCAGCAGAACGCTTTTGATCCGACGGA
TGTGTTCTCCTGTCCCGAAAAGCAGGTGCAGATCTTGCGTACCATAGTGG
ATTTTCACGAACGTGCCGTGGTGCTGCTGCGTGCAGGTATTTCGCTTTCT
GCGCTGTCCCAGCTTTCGTGCCGGGAGCTCATCGTACGTATGAAAACTAC
GTACGGGAATGAGGATGTACACAAGATGCAGAAAGTGTACGACACGATGT
GCACTGAGTTTGACCAACTGAGTGTGTGTGCTGCCGCGCGCACACAAGGG
GGGGAGAAAGTCGAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy