Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR380 IGR379 IGR377 IGR378 IGR375 IGR376 IGR381 atpF, - TP0531 TP0532 TP0530 atpD, - TP0527 atpI, - TP0533 atpB, - TP0528 atpA, - TP0529 lon-2, - TP0524 efp, - TP0525 hrpA, - TP0526 atpF, - TP0531 TP0532 TP0530 atpD, - TP0527 atpI, - TP0533 atpB, - TP0528 atpA, - TP0529 lon-2, - TP0524 efp, - TP0525 hrpA, - TP0526 TP0532 TP0530 atpD, - TP0527 atpI, - TP0533 atpB, - TP0528 atpA, - TP0529 lon-2, - TP0524 atpF, - TP0531 efp, - TP0525 hrpA, - TP0526
* Calculated from Protein Sequence

Gene ID: TP0528

DNA Molecule Name:
1  

Genbank ID:
3322820

Gene Name:
atpB  

Definition:
V-type ATPase subunit B

Gene Start:
572364

Gene Stop:
570925

Gene Length:
1440

Molecular Weight*:
53046

pI*:
5.79

Net Charge*:
-5.71

EC:
3.6.1.34  

Functional Class:
Energy metabolism; ATP-proton motive force interconversion  

Pathway: pathway table
Miscellaneous Enzymes

Comment:
V-type ATPases (more correctly the V-F0F1 type ATPases) are one of two
subgroups of the F0F1-ATPases (the other subgroup being the F-F0F1 type).
The V subgroup are found mainly in archaebacteria and the endomembrane
or vacuolar system of eukaryotic cells. However, there are examples of
V types in eubacteria such as the ntp cluster in Enterococcus hirae.
This cluster is believed to encode a Na-translocating V-type ATPase that
is expressed when the normal F-type ATPase is inoperative.

See TP0424 atpE
See TP0426 atpA
See TP0427 atpB
See TP0428 atpD
See TP0429 atpI
See TP0430 atpK
See TP0527 atpD
See TP0529 atpA
See TP0530 atpE
See TP0531 atpF
See TP0532 atpK
See TP0533 atpI

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to V-ATPase B subunit.
For example residues 1-454 are 57% similar to ATPase beta subunit of
Thermococcus sp.,(D88772).

COGS Summary:  COGS Search
BeTs to 8 clades of COG1156
COG name: Vacuolar ATPase/archaeal ATP synthase B subunit (NtpB)
Functional Class:  C
The phylogenetic pattern of COG1156 is amtky-----------oLin-
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
Residues 74-99, 29-54, 227-238, 247-291, 315-352, and 321-358 represent
significant (100%) hits to blocks BL00152A,B,C,D, ATP synthase alpha
and beta subunits proteins.

ProDom Summary:  Protein Domain Search
Residues 209-388 are 68% similar to V-type ATPase, subunit B of
ATPB_HALSA. Residues 133-186 and 390-424 also support this match.

Paralogs:  Local Blast Search
This protein is paralogously related to TP0427, V-type ATPase,
subunit B (atpB), TP0402, flagellum-specific ATP synthase (fliI),
TP0529 V-type ATPase, subunit A (atpA), and TP0426, V-type ATPase,
subunit A (atpA). Residues 6-457 are 37% similar to TP0427, residues
16-420 are 29% similar to TP0402, residues 131-424 are 25% similar
to TP0529, and residues 57-420 are 24% similar to TP0426.

Pfam Summary:  Pfam Search
Residues 9 to 75 (E-value = 2.5e-10) place TP0528 in the ATP-synt_ab_N family which is described as ATP synthase alpha/beta family, beta-barrel domain (PF02874)
Residues 177 to 356 (E-value = 2.3e-86) place TP0528 in the ATP-synt_ab family which is described as ATP synthase alpha/beta family, nucleotide-binding domain (PF00006)
Residues 367 to 471 (E-value = 7.7e-21) place TP0528 in the ATP-synt_ab_C family which is described as ATP synthase alpha/beta chain, C terminal domain (PF00306)

PDB Hit:
none

Gene Protein Sequence:
MKGVWYRGLSSIDGPIVVAKRREGAFYGEITAIRDRFGALRTGRIIDLSQ
ECCLIQVFGSTLGLSLDGACLEFLDVPMQLRVCEGLMGRVFDGLGRPIDG
FPEVLSSQLRNVNGYPINPYARVYPRDFIQTGISAIDGMNTLIRGQKLPI
FSGNGLAHNRLAAQIIRQAKILGTDEAFVMVFAGMGIKHDVARFFVSSFE
ETGVLSKVVMFLSLADAPSIERIITPRCALTAAEYLAFEKNKHVLVIFTD
MTNYCEALREVSTTRGEVPGRKGYPGYLYSDLAELYERAGRVKGSSGSVT
QIPILTMPNDDISHPIPDLTGYITEGQIVLQRDLSQRGLYPPIGCLPSLS
RLMKDGIGEGMTRADHHAVSSQLFASYARVQSVRSLASIVGEEELPALDK
CYLRFGDLFEQYFLTQDEHEDRSISQTLDIGWSLLSLLPRTELYRIDPKL
IDQYLTASCSAVSDQLRKAIEEARTPVADA

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAGGGAGTGTGGTATCGGGGTCTGTCCTCCATCGACGGTCCGATCGT
GGTGGCAAAGCGCCGGGAAGGTGCATTCTATGGGGAGATTACGGCCATCC
GTGATCGCTTCGGTGCTCTGCGTACCGGCAGGATAATTGATCTTTCTCAA
GAGTGTTGTCTGATTCAGGTGTTTGGCTCCACGCTTGGGCTCAGCCTCGA
CGGTGCCTGCCTTGAGTTTTTGGACGTGCCGATGCAGCTGCGTGTCTGTG
AGGGTTTGATGGGGCGGGTATTCGATGGATTAGGGAGACCAATCGATGGT
TTCCCAGAGGTGCTCTCTTCTCAATTGCGTAATGTGAACGGCTATCCTAT
CAATCCGTACGCGCGCGTATATCCACGTGACTTCATTCAAACCGGTATTT
CTGCTATCGATGGTATGAATACGCTCATTCGTGGGCAGAAACTGCCAATC
TTCTCTGGGAACGGCCTTGCGCACAACCGTTTAGCAGCGCAGATTATCAG
ACAGGCAAAAATTCTTGGCACGGATGAGGCCTTTGTGATGGTATTCGCGG
GTATGGGTATTAAGCACGATGTGGCCCGCTTTTTTGTTTCTTCTTTTGAA
GAAACAGGGGTACTGTCAAAGGTGGTGATGTTCCTGTCGCTTGCAGATGC
GCCATCTATCGAGCGTATTATCACACCACGCTGTGCATTAACCGCAGCTG
AGTATCTCGCCTTTGAAAAGAACAAGCATGTATTAGTCATTTTTACAGAC
ATGACAAACTACTGTGAGGCGCTGCGGGAAGTTTCCACCACACGAGGGGA
GGTACCCGGGCGTAAGGGTTATCCGGGTTACCTGTATTCTGATTTGGCAG
AACTGTACGAGCGCGCAGGCAGAGTGAAAGGATCCTCCGGTTCGGTGACG
CAGATTCCGATCTTAACTATGCCGAACGACGATATTAGCCATCCGATCCC
TGACCTGACCGGGTACATCACCGAAGGACAGATTGTGTTGCAACGCGACC
TATCTCAGCGGGGCTTGTATCCGCCCATTGGGTGTCTACCCAGCCTATCT
CGCTTAATGAAAGATGGTATCGGGGAGGGTATGACACGCGCAGATCACCA
TGCGGTTTCAAGTCAGCTATTTGCTTCATACGCAAGAGTACAAAGCGTAC
GGAGCCTTGCCTCGATTGTCGGAGAAGAGGAATTACCTGCACTCGATAAG
TGTTATCTGCGCTTTGGTGACTTGTTTGAGCAGTACTTTCTCACGCAGGA
TGAGCATGAAGATCGGAGTATCAGTCAGACGCTCGATATCGGGTGGAGTT
TGCTCTCACTTTTGCCGCGCACCGAGCTATATCGTATCGACCCAAAGCTT
ATCGATCAGTACCTGACCGCTTCGTGCAGCGCGGTGAGTGATCAGTTGCG
AAAGGCGATAGAGGAGGCCCGCACCCCGGTTGCGGACGCG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy